Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTFXFREP)

DOT Name Baculoviral IAP repeat-containing protein 2 (BIRC2)
Synonyms
EC 2.3.2.27; Cellular inhibitor of apoptosis 1; C-IAP1; IAP homolog B; Inhibitor of apoptosis protein 2; hIAP-2; hIAP2; RING finger protein 48; RING-type E3 ubiquitin transferase BIRC2; TNFR2-TRAF-signaling complex protein 2
Gene Name BIRC2
UniProt ID
BIRC2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1QBH; 2L9M; 3D9T; 3D9U; 3M1D; 3MUP; 3OZ1; 3T6P; 3UW4; 4EB9; 4HY4; 4HY5; 4KMN; 4LGE; 4LGU; 4MTI; 4MU7; 5M6N; 6EXW; 6HPR; 6W74; 6W7O; 6W8I; 7QGJ; 7TRL; 7TRM; 8DSF; 8DSO
EC Number
2.3.2.27
Pfam ID
PF00653 ; PF21290 ; PF00619 ; PF13920
Sequence
MHKTASQRLFPGPSYQNIKSIMEDSTILSDWTNSNKQKMKYDFSCELYRMSTYSTFPAGV
PVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFIQNLVSAS
LGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYA
MSTEEARFLTYHMWPLTFLSPSELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEH
RRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGR
NDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLLEQLL
STSDTTGEENADPPIIHFGPGESSSEDAVMMNTPVVKSALEMGFNRDLVKQTVQSKILTT
GENYKTVNDIVSALLNAEDEKREEEKEKQAEEMASDDLSLIRKNRMALFQQLTCVLPILD
NLLKANVINKQEHDIIKQKTQIPLQARELIDTILVKGNAAANIFKNCLKEIDSTLYKNLF
VDKNMKYIPTEDVSGLSLEEQLRRLQEERTCKVCMDKEVSVVFIPCGHLVVCQECAPSLR
KCPICRGIIKGTVRTFLS
Function
Multi-functional protein which regulates not only caspases and apoptosis, but also modulates inflammatory signaling and immunity, mitogenic kinase signaling, and cell proliferation, as well as cell invasion and metastasis. Acts as an E3 ubiquitin-protein ligase regulating NF-kappa-B signaling and regulates both canonical and non-canonical NF-kappa-B signaling by acting in opposite directions: acts as a positive regulator of the canonical pathway and suppresses constitutive activation of non-canonical NF-kappa-B signaling. The target proteins for its E3 ubiquitin-protein ligase activity include: RIPK1, RIPK2, RIPK3, RIPK4, CASP3, CASP7, CASP8, TRAF2, DIABLO/SMAC, MAP3K14/NIK, MAP3K5/ASK1, IKBKG/NEMO, IKBKE and MXD1/MAD1. Can also function as an E3 ubiquitin-protein ligase of the NEDD8 conjugation pathway, targeting effector caspases for neddylation and inactivation. Acts as an important regulator of innate immune signaling via regulation of Toll-like receptors (TLRs), Nodlike receptors (NLRs) and RIG-I like receptors (RLRs), collectively referred to as pattern recognition receptors (PRRs). Protects cells from spontaneous formation of the ripoptosome, a large multi-protein complex that has the capability to kill cancer cells in a caspase-dependent and caspase-independent manner. Suppresses ripoptosome formation by ubiquitinating RIPK1 and CASP8. Can stimulate the transcriptional activity of E2F1. Plays a role in the modulation of the cell cycle.
Tissue Specificity Present in many fetal and adult tissues. Mainly expressed in adult skeletal muscle, thymus, testis, ovary, and pancreas, low or absent in brain and peripheral blood leukocytes.
KEGG Pathway
Platinum drug resistance (hsa01524 )
NF-kappa B sig.ling pathway (hsa04064 )
Ubiquitin mediated proteolysis (hsa04120 )
Apoptosis (hsa04210 )
Apoptosis - multiple species (hsa04215 )
Necroptosis (hsa04217 )
Hippo sig.ling pathway (hsa04390 )
Focal adhesion (hsa04510 )
NOD-like receptor sig.ling pathway (hsa04621 )
TNF sig.ling pathway (hsa04668 )
Salmonella infection (hsa05132 )
Toxoplasmosis (hsa05145 )
Herpes simplex virus 1 infection (hsa05168 )
Pathways in cancer (hsa05200 )
Transcriptio.l misregulation in cancer (hsa05202 )
Small cell lung cancer (hsa05222 )
Reactome Pathway
NOD1/2 Signaling Pathway (R-HSA-168638 )
TICAM1, RIP1-mediated IKK complex recruitment (R-HSA-168927 )
RIPK1-mediated regulated necrosis (R-HSA-5213460 )
TNFR1-induced proapoptotic signaling (R-HSA-5357786 )
Regulation of TNFR1 signaling (R-HSA-5357905 )
TNFR1-induced NF-kappa-B signaling pathway (R-HSA-5357956 )
TNFR2 non-canonical NF-kB pathway (R-HSA-5668541 )
Regulation of necroptotic cell death (R-HSA-5675482 )
TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway (R-HSA-5676594 )
Ub-specific processing proteases (R-HSA-5689880 )
IKK complex recruitment mediated by RIP1 (R-HSA-937041 )
Apoptotic cleavage of cellular proteins (R-HSA-111465 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 7 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Cisplatin DMRHGI9 Approved Baculoviral IAP repeat-containing protein 2 (BIRC2) decreases the response to substance of Cisplatin. [50]
Mitomycin DMH0ZJE Approved Baculoviral IAP repeat-containing protein 2 (BIRC2) affects the response to substance of Mitomycin. [51]
Topotecan DMP6G8T Approved Baculoviral IAP repeat-containing protein 2 (BIRC2) affects the response to substance of Topotecan. [51]
Vinblastine DM5TVS3 Approved Baculoviral IAP repeat-containing protein 2 (BIRC2) affects the response to substance of Vinblastine. [51]
Bleomycin DMNER5S Approved Baculoviral IAP repeat-containing protein 2 (BIRC2) decreases the response to substance of Bleomycin. [50]
Chlorambucil DMRKE63 Approved Baculoviral IAP repeat-containing protein 2 (BIRC2) decreases the response to substance of Chlorambucil. [50]
Thioguanine DM7NKEV Approved Baculoviral IAP repeat-containing protein 2 (BIRC2) decreases the response to substance of Thioguanine. [50]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Drug(s)
50 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [1]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [2]
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [3]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [4]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [5]
Calcitriol DM8ZVJ7 Approved Calcitriol decreases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [6]
Decitabine DMQL8XJ Approved Decitabine affects the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [7]
Zoledronate DMIXC7G Approved Zoledronate decreases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [8]
Fluorouracil DMUM7HZ Approved Fluorouracil increases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [9]
Folic acid DMEMBJC Approved Folic acid increases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [10]
Bortezomib DMNO38U Approved Bortezomib decreases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [11]
Etoposide DMNH3PG Approved Etoposide increases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [12]
Paclitaxel DMLB81S Approved Paclitaxel decreases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [13]
Nicotine DMWX5CO Approved Nicotine increases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [14]
Simvastatin DM30SGU Approved Simvastatin decreases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [15]
Gemcitabine DMSE3I7 Approved Gemcitabine increases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [9]
Mitoxantrone DMM39BF Approved Mitoxantrone decreases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [16]
Capsaicin DMGMF6V Approved Capsaicin increases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [17]
Adenosine DMM2NSK Approved Adenosine decreases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [18]
Crizotinib DM4F29C Approved Crizotinib decreases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [19]
Trovafloxacin DM6AN32 Approved Trovafloxacin decreases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [20]
Etodolac DM6WJO9 Approved Etodolac decreases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [21]
Bendamustine hydrochloride DMFH15Z Approved Bendamustine hydrochloride decreases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [16]
Aprepitant DM053KT Approved Aprepitant decreases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [22]
Resveratrol DM3RWXL Phase 3 Resveratrol increases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [23]
Curcumin DMQPH29 Phase 3 Curcumin decreases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [24]
Fenretinide DMRD5SP Phase 3 Fenretinide decreases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [25]
Chlorpromazine DMBGZI3 Phase 3 Trial Chlorpromazine decreases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [26]
Buparlisib DM1WEHC Phase 3 Buparlisib decreases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [27]
Pelitinib DMIW453 Phase 2 Pelitinib decreases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [29]
LCL161 DMTM4QA Phase 2 LCL161 decreases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [30]
LY294002 DMY1AFS Phase 1 LY294002 decreases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [31]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [32]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN decreases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [34]
Wortmannin DM8EVK5 Terminated Wortmannin decreases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [31]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [35]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [36]
Paraquat DMR8O3X Investigative Paraquat decreases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [37]
Glyphosate DM0AFY7 Investigative Glyphosate decreases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [38]
GALLICACID DM6Y3A0 Investigative GALLICACID decreases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [39]
KOJIC ACID DMP84CS Investigative KOJIC ACID decreases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [40]
cinnamaldehyde DMZDUXG Investigative cinnamaldehyde decreases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [41]
acrolein DMAMCSR Investigative acrolein increases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [42]
Tributylstannanyl DMHN7CB Investigative Tributylstannanyl decreases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [43]
Linalool DMGZQ5P Investigative Linalool increases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [44]
15-deoxy-Delta(12, 14)-prostaglandin J(2) DM8VUX3 Investigative 15-deoxy-Delta(12, 14)-prostaglandin J(2) decreases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [45]
Protoporphyrin IX DMWYE7A Investigative Protoporphyrin IX increases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [46]
Morin DM2OGZ5 Investigative Morin decreases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [47]
BAY11-7082 DMQNOFA Investigative BAY11-7082 decreases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [48]
Caffeic acid phenethyl ester DMRJKIV Investigative Caffeic acid phenethyl ester decreases the expression of Baculoviral IAP repeat-containing protein 2 (BIRC2). [49]
------------------------------------------------------------------------------------
⏷ Show the Full List of 50 Drug(s)
1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT
Drug Name Drug ID Highest Status Interaction REF
phorbol 12-myristate 13-acetate DMJWD62 Phase 2 phorbol 12-myristate 13-acetate affects the localization of Baculoviral IAP repeat-containing protein 2 (BIRC2). [28]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of Baculoviral IAP repeat-containing protein 2 (BIRC2). [33]
------------------------------------------------------------------------------------

References

1 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
2 Benzodithiophenes potentiate differentiation of acute promyelocytic leukemia cells by lowering the threshold for ligand-mediated corepressor/coactivator exchange with retinoic acid receptor alpha and enhancing changes in all-trans-retinoic acid-regulated gene expression. Cancer Res. 2005 Sep 1;65(17):7856-65. doi: 10.1158/0008-5472.CAN-05-1056.
3 Rapid induction of IAP family proteins and Smac/DIABLO expression after proapoptotic stimulation with doxorubicin in RPMI 8226 multiple myeloma cells. Exp Mol Pathol. 2007 Dec;83(3):405-12. doi: 10.1016/j.yexmp.2007.04.001. Epub 2007 Apr 18.
4 (4-Picolylamino)-17-Estradiol derivative and analogues induce apoptosis with death receptor trail R2/DR5 in MCF-7. Chem Biol Interact. 2023 Jan 5;369:110286. doi: 10.1016/j.cbi.2022.110286. Epub 2022 Nov 29.
5 Inhibition of PI3K pathway using BKM120 intensified the chemo-sensitivity of breast cancer cells to arsenic trioxide (ATO). Int J Biochem Cell Biol. 2019 Nov;116:105615. doi: 10.1016/j.biocel.2019.105615. Epub 2019 Sep 17.
6 Apoptosis induction by 1alpha,25-dihydroxyvitamin D3 in prostate cancer. Mol Cancer Ther. 2002 Jul;1(9):667-77.
7 Downmodulation of dimethyl transferase activity enhances tumor necrosis factor-related apoptosis-inducing ligand-induced apoptosis in prostate cancer cells. Int J Oncol. 2008 Aug;33(2):381-8.
8 Effect of zoledronic acid on oral fibroblasts and epithelial cells: a potential mechanism of bisphosphonate-associated osteonecrosis. Br J Haematol. 2009 Mar;144(5):667-76. doi: 10.1111/j.1365-2141.2008.07504.x. Epub 2008 Nov 20.
9 Gene expression profiling of breast cancer cells in response to gemcitabine: NF-kappaB pathway activation as a potential mechanism of resistance. Breast Cancer Res Treat. 2007 Apr;102(2):157-72.
10 [Homocysteine-induced apoptosis of endothelial cell and its antagonism by folic acid--the roles of caspase3, c-IAP1 and c-IAP2]. Wei Sheng Yan Jiu. 2004 May;33(3):310-3.
11 Efficacy and mechanism of action of the proteasome inhibitor PS-341 in T-cell lymphomas and HTLV-I associated adult T-cell leukemia/lymphoma. Oncogene. 2005 Jan 13;24(3):419-30. doi: 10.1038/sj.onc.1208212.
12 Translation of cellular inhibitor of apoptosis protein 1 (c-IAP1) mRNA is IRES mediated and regulated during cell stress. RNA. 2004 Mar;10(3):469-81. doi: 10.1261/rna.5156804.
13 Resveratrol modifies the expression of apoptotic regulatory proteins and sensitizes non-Hodgkin's lymphoma and multiple myeloma cell lines to paclitaxel-induced apoptosis. Mol Cancer Ther. 2004 Jan;3(1):71-84.
14 Nicotine-induced survival signaling in lung cancer cells is dependent on their p53 status while its down-regulation by curcumin is independent. Mol Cancer. 2010 Aug 20;9:220.
15 Simvastatin induces apoptosis in human colon cancer cells and in tumor xenografts, and attenuates colitis-associated colon cancer in mice. Int J Cancer. 2008 Aug 15;123(4):951-7. doi: 10.1002/ijc.23593.
16 Upon drug-induced apoptosis in lymphoma cells X-linked inhibitor of apoptosis (XIAP) translocates from the cytosol to the nucleus. Leuk Lymphoma. 2004 Jul;45(7):1429-36. doi: 10.1080/1042819042000198858.
17 Triggering of transient receptor potential vanilloid type 1 (TRPV1) by capsaicin induces Fas/CD95-mediated apoptosis of urothelial cancer cells in an ATM-dependent manner. Carcinogenesis. 2009 Aug;30(8):1320-9. doi: 10.1093/carcin/bgp138. Epub 2009 Jun 5.
18 Adenosine-induced caspase-3 activation by tuning Bcl-XL/DIABLO/IAP expression in HuH-7 human hepatoma cells. Cell Biol Toxicol. 2010 Aug;26(4):319-30. doi: 10.1007/s10565-009-9145-7. Epub 2010 Jan 9.
19 Antitumor action of the MET tyrosine kinase inhibitor crizotinib (PF-02341066) in gastric cancer positive for MET amplification. Mol Cancer Ther. 2012 Jul;11(7):1557-64. doi: 10.1158/1535-7163.MCT-11-0934. Epub 2012 Jun 22.
20 The hepatotoxic fluoroquinolone trovafloxacin disturbs TNF- and LPS-induced p65 nuclear translocation in vivo and in vitro. Toxicol Appl Pharmacol. 2020 Mar 15;391:114915. doi: 10.1016/j.taap.2020.114915. Epub 2020 Feb 6.
21 Etodolac inhibits EBER expression and induces Bcl-2-regulated apoptosis in Burkitt's lymphoma cells. Eur J Haematol. 2005 Sep;75(3):212-20. doi: 10.1111/j.1600-0609.2005.00498.x.
22 Neurokinin-1 receptor (NK1R) inhibition sensitizes APL cells to anti-tumor effect of arsenic trioxide via restriction of NF-B axis: Shedding new light on resistance to Aprepitant. Int J Biochem Cell Biol. 2018 Oct;103:105-114. doi: 10.1016/j.biocel.2018.08.010. Epub 2018 Aug 23.
23 Differential expression of genes induced by resveratrol in LNCaP cells: P53-mediated molecular targets. Int J Cancer. 2003 Mar 20;104(2):204-12.
24 The antitumor activities of curcumin and of its isoxazole analogue are not affected by multiple gene expression changes in an MDR model of the MCF-7 breast cancer cell line: analysis of the possible molecular basis. Int J Mol Med. 2007 Sep;20(3):329-35.
25 N-(4-hydroxyphenyl)retinamide inhibits invasion, suppresses osteoclastogenesis, and potentiates apoptosis through down-regulation of I(kappa)B(alpha) kinase and nuclear factor-kappaB-regulated gene products. Cancer Res. 2005 Oct 15;65(20):9555-65. doi: 10.1158/0008-5472.CAN-05-1585.
26 The antipsychotic chlorpromazine suppresses YAP signaling, stemness properties, and drug resistance in breast cancer cells. Chem Biol Interact. 2019 Apr 1;302:28-35. doi: 10.1016/j.cbi.2019.01.033. Epub 2019 Jan 28.
27 Inhibition of PI3K signaling pathway enhances the chemosensitivity of APL cells to ATO: Proposing novel therapeutic potential for BKM120. Eur J Pharmacol. 2018 Dec 15;841:10-18. doi: 10.1016/j.ejphar.2018.10.007. Epub 2018 Oct 11.
28 Translocation of the inhibitor of apoptosis protein c-IAP1 from the nucleus to the Golgi in hematopoietic cells undergoing differentiation: a nuclear export signal-mediated event. Blood. 2004 Oct 1;104(7):2035-43. doi: 10.1182/blood-2004-01-0065. Epub 2004 Jun 8.
29 Irreversible EGFR inhibitor EKB-569 targets low-LET -radiation-triggered rel orchestration and potentiates cell death in squamous cell carcinoma. PLoS One. 2011;6(12):e29705. doi: 10.1371/journal.pone.0029705. Epub 2011 Dec 29.
30 The SMAC mimetic LCL161 is a direct ABCB1/MDR1-ATPase activity modulator and BIRC5/Survivin expression down-regulator in cancer cells. Toxicol Appl Pharmacol. 2020 Aug 15;401:115080. doi: 10.1016/j.taap.2020.115080. Epub 2020 Jun 1.
31 Phosphatidylinositol 3-kinase inhibition down-regulates survivin and facilitates TRAIL-mediated apoptosis in neuroblastomas. J Pediatr Surg. 2004 Apr;39(4):516-21. doi: 10.1016/j.jpedsurg.2003.12.008.
32 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
33 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
34 Tissue transglutaminase serves as an inhibitor of apoptosis by cross-linking caspase 3 in thapsigargin-treated cells. Mol Cell Biol. 2006 Jan;26(2):569-79.
35 Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
36 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
37 Identification of genes associated with paraquat-induced toxicity in SH-SY5Y cells by PCR array focused on apoptotic pathways. J Toxicol Environ Health A. 2008;71(22):1457-67. doi: 10.1080/15287390802329364.
38 Glyphosate-based herbicides at low doses affect canonical pathways in estrogen positive and negative breast cancer cell lines. PLoS One. 2019 Jul 11;14(7):e0219610. doi: 10.1371/journal.pone.0219610. eCollection 2019.
39 Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.
40 Toxicogenomics of kojic acid on gene expression profiling of a375 human malignant melanoma cells. Biol Pharm Bull. 2006 Apr;29(4):655-69.
41 Effects of vitamin E on the cinnamaldehyde-induced apoptotic mechanism in human PLC/PRF/5 cells. Clin Exp Pharmacol Physiol. 2004 Nov;31(11):770-6. doi: 10.1111/j.1440-1681.2004.04091.x.
42 Acrolein induces a cellular stress response and triggers mitochondrial apoptosis in A549 cells. Chem Biol Interact. 2009 Oct 7;181(2):154-67. doi: 10.1016/j.cbi.2009.07.001. Epub 2009 Jul 9.
43 Toxicogenomic analysis identifies the apoptotic pathway as the main cause of hepatotoxicity induced by tributyltin. Food Chem Toxicol. 2016 Nov;97:316-326. doi: 10.1016/j.fct.2016.09.027. Epub 2016 Sep 24.
44 Linalool preferentially induces robust apoptosis of a variety of leukemia cells via upregulating p53 and cyclin-dependent kinase inhibitors. Toxicology. 2010 Jan 31;268(1-2):19-24. doi: 10.1016/j.tox.2009.11.013. Epub 2009 Nov 14.
45 15-Deoxy-delta 12,14-prostaglandin J2 induces apoptosis in human malignant B cells: an effect associated with inhibition of NF-kappa B activity and down-regulation of antiapoptotic proteins. Blood. 2005 Feb 15;105(4):1750-8. doi: 10.1182/blood-2004-04-1360. Epub 2004 Oct 21.
46 Upregulation of heme oxygenase-1 and p21 confers resistance to apoptosis in human gastric cancer cells. Oncogene. 2004 Jan 15;23(2):503-13. doi: 10.1038/sj.onc.1207173.
47 Molecular mechanism of anti-cancerous potential of Morin extracted from mulberry in Hela cells. Food Chem Toxicol. 2018 Feb;112:466-475. doi: 10.1016/j.fct.2017.07.002. Epub 2017 Jul 6.
48 NF-kappaB is essential for the progression of KSHV- and EBV-infected lymphomas in vivo. Blood. 2006 Apr 15;107(8):3295-302. doi: 10.1182/blood-2005-07-2730. Epub 2005 Dec 27.
49 Caffeic acid phenethyl ester-induced PC-3 cell apoptosis is caspase-dependent and mediated through the loss of inhibitors of apoptosis proteins. BJU Int. 2004 Aug;94(3):402-6. doi: 10.1111/j.1464-410X.2004.04936.x.
50 Expression and prognostic significance of IAP-family genes in human cancers and myeloid leukemias. Clin Cancer Res. 2000 May;6(5):1796-803.
51 Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.