Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTFZN66E)

• DOT Name: RNA-binding motif protein, X chromosome (RBMX)
• Synonyms: Glycoprotein p43; Heterogeneous nuclear ribonucleoprotein G; hnRNP G
• Gene Name: RBMX
• Related Disease:
  Non-small-cell lung cancer
  Astrocytoma
  Breast neoplasm
  Endometrial cancer
  Endometrial carcinoma
  Frontotemporal dementia
  Intellectual disability
  Neoplasm
  Neoplasm with perivascular epithelioid cell differentiation
  Oral cancer
  Pick disease
  Precancerous condition
  Systemic lupus erythematosus
  Advanced cancer
  Lung neoplasm
  Squamous cell carcinoma
  Syndromic X-linked intellectual disability Shashi type
  Thyroid gland papillary carcinoma
• UniProt ID: RBMX_HUMAN
• PDB ID: 2MB0; 2MKS
• Pfam ID: PF08081 ; PF00076
• Sequence:
  MVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPA
  DAKDAARDMNGKSLDGKAIKVEQATKPSFESGRRGPPPPPRSRGPPRGLRGGRGGSGGTR
  GPPSRGGHMDDGGYSMNFNMSSSRGPLPVKRGPPPRSGGPPPKRSAPSGPVRSSSGMGGR
  APVSRGRDSYGGPPRREPLPSRRDVYLSPRDDGYSTKDSYSSRDYPSSRDTRDYAPPPRD
  YTYRDYGHSSSRDDYPSRGYSDRDGYGRDRDYSDHPSGGSYRDSYESYGNSRSAPPTRGP
  PPSYGGSSRYDDYSSSRDGYGGSRDSYSSSRSDLYSSGRDRVGRQERGLPPSMERGYPPP
  RDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY
• Function: RNA-binding protein that plays several role in the regulation of pre- and post-transcriptional processes. Implicated in tissue-specific regulation of gene transcription and alternative splicing of several pre-mRNAs. Binds to and stimulates transcription from the tumor suppressor TXNIP gene promoter; may thus be involved in tumor suppression. When associated with SAFB, binds to and stimulates transcription from the SREBF1 promoter. Associates with nascent mRNAs transcribed by RNA polymerase II. Component of the supraspliceosome complex that regulates pre-mRNA alternative splice site selection. Can either activate or suppress exon inclusion; acts additively with TRA2B to promote exon 7 inclusion of the survival motor neuron SMN2. Represses the splicing of MAPT/Tau exon 10. Binds preferentially to single-stranded 5'-CC[A/C]-rich RNA sequence motifs localized in a single-stranded conformation; probably binds RNA as a homodimer. Binds non-specifically to pre-mRNAs. Also plays a role in the cytoplasmic TNFR1 trafficking pathways; promotes both the IL-1-beta-mediated inducible proteolytic cleavage of TNFR1 ectodomains and the release of TNFR1 exosome-like vesicles to the extracellular compartment.
• Tissue Specificity: Expressed strongly in oral keratinocytes, but only weakly detected in oral squamous cell carcinomas (at protein level).
• KEGG Pathway: Spliceosome (hsa03040)
• Reactome Pathway:
  Processing of Capped Intron-Containing Pre-mRNA (R-HSA-72203)
  RHOBTB2 GTPase cycle (R-HSA-9013418)
  RHOBTB1 GTPase cycle (R-HSA-9013422)
  RND3 GTPase cycle (R-HSA-9696264)
  RND2 GTPase cycle (R-HSA-9696270)
  RND1 GTPase cycle (R-HSA-9696273)
  mRNA Splicing - Major Pathway (R-HSA-72163)

Molecular Interaction Atlas (MIA) of This DOT

18 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Non-small-cell lung cancer	DIS5Y6R9	Definitive	Altered Expression	[1]
Astrocytoma	DISL3V18	Strong	Altered Expression	[2]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[3]
Endometrial cancer	DISW0LMR	Strong	Biomarker	[4]
Endometrial carcinoma	DISXR5CY	Strong	Biomarker	[4]
Frontotemporal dementia	DISKYHXL	Strong	Biomarker	[5]
Intellectual disability	DISMBNXP	Strong	Biomarker	[6]
Neoplasm	DISZKGEW	Strong	Biomarker	[7]
Neoplasm with perivascular epithelioid cell differentiation	DIS8V0NT	Strong	Biomarker	[8]
Oral cancer	DISLD42D	Strong	Altered Expression	[7]
Pick disease	DISP6X50	Strong	Biomarker	[5]
Precancerous condition	DISV06FL	Strong	Altered Expression	[7]
Systemic lupus erythematosus	DISI1SZ7	Strong	Biomarker	[9]
Advanced cancer	DISAT1Z9	moderate	Biomarker	[10]
Lung neoplasm	DISVARNB	moderate	Altered Expression	[10]
Squamous cell carcinoma	DISQVIFL	moderate	Altered Expression	[11]
Syndromic X-linked intellectual disability Shashi type	DISNG85G	Moderate	X-linked	[12]
Thyroid gland papillary carcinoma	DIS48YMM	Limited	Biomarker	[13]

21 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of RNA-binding motif protein, X chromosome (RBMX).	[14]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of RNA-binding motif protein, X chromosome (RBMX).	[15]
Doxorubicin	DMVP5YE	Approved	Doxorubicin affects the expression of RNA-binding motif protein, X chromosome (RBMX).	[16]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of RNA-binding motif protein, X chromosome (RBMX).	[17]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of RNA-binding motif protein, X chromosome (RBMX).	[18]
Arsenic	DMTL2Y1	Approved	Arsenic increases the expression of RNA-binding motif protein, X chromosome (RBMX).	[19]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of RNA-binding motif protein, X chromosome (RBMX).	[20]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of RNA-binding motif protein, X chromosome (RBMX).	[21]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of RNA-binding motif protein, X chromosome (RBMX).	[22]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of RNA-binding motif protein, X chromosome (RBMX).	[23]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of RNA-binding motif protein, X chromosome (RBMX).	[24]
Menadione	DMSJDTY	Approved	Menadione affects the expression of RNA-binding motif protein, X chromosome (RBMX).	[25]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of RNA-binding motif protein, X chromosome (RBMX).	[26]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate decreases the expression of RNA-binding motif protein, X chromosome (RBMX).	[27]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the expression of RNA-binding motif protein, X chromosome (RBMX).	[27]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of RNA-binding motif protein, X chromosome (RBMX).	[29]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of RNA-binding motif protein, X chromosome (RBMX).	[31]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde decreases the expression of RNA-binding motif protein, X chromosome (RBMX).	[32]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate increases the expression of RNA-binding motif protein, X chromosome (RBMX).	[33]
AHPN	DM8G6O4	Investigative	AHPN decreases the expression of RNA-binding motif protein, X chromosome (RBMX).	[34]
PP-242	DM2348V	Investigative	PP-242 increases the expression of RNA-binding motif protein, X chromosome (RBMX).	[35]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of RNA-binding motif protein, X chromosome (RBMX).	[28]
Coumarin	DM0N8ZM	Investigative	Coumarin increases the phosphorylation of RNA-binding motif protein, X chromosome (RBMX).	[30]

References

• [1] Expression profiles of SV40-immortalization-associated genes upregulated in various human cancers.J Cell Biochem. 2009 Mar 1;106(4):703-13. doi: 10.1002/jcb.22063.
• [2] Differential expression of the RNA-binding motif protein 3 in human astrocytoma.Chin Med J (Engl). 2013;126(10):1948-52.
• [3] Positive correlation between the expression of X-chromosome RBM genes (RBMX, RBM3, RBM10) and the proapoptotic Bax gene in human breast cancer.J Cell Biochem. 2006 Apr 15;97(6):1275-82. doi: 10.1002/jcb.20725.
• [4] HNRNP G and HTRA2-BETA1 regulate estrogen receptor alpha expression with potential impact on endometrial cancer.BMC Cancer. 2015 Feb 27;15:86. doi: 10.1186/s12885-015-1088-1.
• [5] An SRp75/hnRNPG complex interacting with hnRNPE2 regulates the 5' splice site of tau exon 10, whose misregulation causes frontotemporal dementia.Gene. 2011 Oct 10;485(2):130-8. doi: 10.1016/j.gene.2011.06.020. Epub 2011 Jun 30.
• [6] The RBMX gene as a candidate for the Shashi X-linked intellectual disability syndrome. Clin Genet. 2015 Oct;88(4):386-90. doi: 10.1111/cge.12511. Epub 2014 Dec 5.
• [7] Expression and mutation analysis of heterogeneous nuclear ribonucleoprotein G in human oral cancer.Oral Oncol. 2011 Nov;47(11):1011-6. doi: 10.1016/j.oraloncology.2011.07.012. Epub 2011 Aug 12.
• [8] A novel RBMX-TFE3 gene fusion in a highly aggressive pediatric renal perivascular epithelioid cell tumor.Genes Chromosomes Cancer. 2020 Jan;59(1):58-63. doi: 10.1002/gcc.22801. Epub 2019 Sep 2.
• [9] Autoimmune antibodies to hnRNPG protein in dogs with systemic lupus erythematosus: epitope mapping of the antigen.J Autoimmun. 2002 May;18(3):221-9. doi: 10.1006/jaut.2002.0584.
• [10] Oligogenic germline mutations identified in early non-smokers lung adenocarcinoma patients.Lung Cancer. 2014 Aug;85(2):168-74. doi: 10.1016/j.lungcan.2014.05.020. Epub 2014 Jun 4.
• [11] Heterogeneous nuclear ribonucleoprotein G, nitric oxide, and oral carcinogenesis.Nitric Oxide. 2008 Sep;19(2):125-32. doi: 10.1016/j.niox.2008.04.012. Epub 2008 Apr 24.
• [12] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [13] Vemurafenib-resistance via de novo RBM genes mutations and chromosome 5 aberrations is overcome by combined therapy with palbociclib in thyroid carcinoma with BRAF(V600E).Oncotarget. 2017 Sep 24;8(49):84743-84760. doi: 10.18632/oncotarget.21262. eCollection 2017 Oct 17.
• [14] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [15] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [16] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [17] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [18] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [19] Role of N6-methyladenosine RNA modification in the imbalanced inflammatory homeostasis of arsenic-induced skin lesions. Environ Toxicol. 2022 Aug;37(8):1831-1839. doi: 10.1002/tox.23530. Epub 2022 Apr 1.
• [20] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [21] Gene expression profile changes in NB4 cells induced by arsenic trioxide. Acta Pharmacol Sin. 2003 Jul;24(7):646-50.
• [22] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [23] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [24] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [25] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [26] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [27] Comparative proteomics reveals concordant and discordant biochemical effects of caffeine versus epigallocatechin-3-gallate in human endothelial cells. Toxicol Appl Pharmacol. 2019 Sep 1;378:114621. doi: 10.1016/j.taap.2019.114621. Epub 2019 Jun 10.
• [28] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [29] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [30] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [31] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [32] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
• [33] Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
• [34] ST1926, a novel and orally active retinoid-related molecule inducing apoptosis in myeloid leukemia cells: modulation of intracellular calcium homeostasis. Blood. 2004 Jan 1;103(1):194-207.
• [35] Marine biogenics in sea spray aerosols interact with the mTOR signaling pathway. Sci Rep. 2019 Jan 24;9(1):675.