Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTG7MEAJ)

• DOT Name: Coronin-7 (CORO7)
• Synonyms: Crn7; 70 kDa WD repeat tumor rejection antigen homolog
• Gene Name: CORO7
• Related Disease:
  Neoplasm
  Adrenal cortex neoplasm
  Adult respiratory distress syndrome
  Analgesia
  Blindness
  Crohn disease
  Delirium
  Hepatocellular carcinoma
  Hyperglycemia
  Hyperparathyroidism
  Hypoparathyroidism
  Hypophosphatemia
  Knee osteoarthritis
  Schizophrenia
  Thrombophilia
  Adrenocortical insufficiency
  Chronic renal failure
  Colorectal carcinoma
  End-stage renal disease
  Sarcoma
  Soft tissue sarcoma
  Tetralogy of fallot
  Urinary tract infection
  Adrenocortical carcinoma
  Aplasia cutis congenita
  Corpus callosum, agenesis of
  Gastric cancer
  Rectal carcinoma
  Stomach cancer
• UniProt ID: CORO7_HUMAN
• Pfam ID: PF08953 ; PF00400 ; PF16300
• Sequence:
  MNRFRVSKFRHTEARPPRRESWISDIRAGTAPSCRNHIKSSCSLIAFNSDRPGVLGIVPL
  QGQGEDKRRVAHLGCHSDLVTDLDFSPFDDFLLATGSADRTVKLWRLPGPGQALPSAPGV
  VLGPEDLPVEVLQFHPTSDGILVSAAGTTVKVWDAAKQQPLTELAAHGDLVQSAVWSRDG
  ALVGTACKDKQLRIFDPRTKPRASQSTQAHENSRDSRLAWMGTWEHLVSTGFNQMREREV
  KLWDTRFFSSALASLTLDTSLGCLVPLLDPDSGLLVLAGKGERQLYCYEVVPQQPALSPV
  TQCVLESVLRGAALVPRQALAVMSCEVLRVLQLSDTAIVPIGYHVPRKAVEFHEDLFPDT
  AGCVPATDPHSWWAGDNQQVQKVSLNPACRPHPSFTSCLVPPAEPLPDTAQPAVMETPVG
  DADASEGFSSPPSSLTSPSTPSSLGPSLSSTSGIGTSPSLRSLQSLLGPSSKFRHAQGTV
  LHRDSHITNLKGLNLTTPGESDGFCANKLRVAVPLLSSGGQVAVLELRKPGRLPDTALPT
  LQNGAAVTDLAWDPFDPHRLAVAGEDARIRLWRVPAEGLEEVLTTPETVLTGHTEKICSL
  RFHPLAANVLASSSYDLTVRIWDLQAGADRLKLQGHQDQIFSLAWSPDGQQLATVCKDGR
  VRVYRPRSGPEPLQEGPGPKGGRGARIVWVCDGRCLLVSGFDSQSERQLLLYEAEALAGG
  PLAVLGLDVAPSTLLPSYDPDTGLVLLTGKGDTRVFLYELLPESPFFLECNSFTSPDPHK
  GLVLLPKTECDVREVELMRCLRLRQSSLEPVAFRLPRVRKEFFQDDVFPDTAVIWEPVLS
  AEAWLQGANGQPWLLSLQPPDMSPVSQAPREAPARRAPSSAQYLEEKSDQQKKEELLNAM
  VAKLGNREDPLPQDSFEGVDEDEWD
• Function: F-actin regulator involved in anterograde Golgi to endosome transport: upon ubiquitination via 'Lys-33'-linked ubiquitin chains by the BCR(KLHL20) E3 ubiquitin ligase complex, interacts with EPS15 and localizes to the trans-Golgi network, where it promotes actin polymerization, thereby facilitating post-Golgi trafficking. May play a role in the maintenance of the Golgi apparatus morphology.
• Tissue Specificity: Widely expressed. Expressed in the spleen, peripheral leukocytes, testes, brain, thymus and small intestine.

Molecular Interaction Atlas (MIA) of This DOT

29 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Neoplasm	DISZKGEW	Definitive	Biomarker	[1]
Adrenal cortex neoplasm	DISO17X1	Strong	Altered Expression	[2]
Adult respiratory distress syndrome	DISIJV47	Strong	Altered Expression	[3]
Analgesia	DISK3TVI	Strong	Biomarker	[4]
Blindness	DISTIM10	Strong	Biomarker	[5]
Crohn disease	DIS2C5Q8	Strong	Biomarker	[6]
Delirium	DIS2OKP1	Strong	Biomarker	[7]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[2]
Hyperglycemia	DIS0BZB5	Strong	Altered Expression	[8]
Hyperparathyroidism	DIS4FVAT	Strong	Biomarker	[9]
Hypoparathyroidism	DISICS0V	Strong	Biomarker	[9]
Hypophosphatemia	DIS9DZYF	Strong	Biomarker	[10]
Knee osteoarthritis	DISLSNBJ	Strong	Genetic Variation	[11]
Schizophrenia	DISSRV2N	Strong	Genetic Variation	[12]
Thrombophilia	DISQR7U7	Strong	Biomarker	[13]
Adrenocortical insufficiency	DISZ0CPT	moderate	Biomarker	[14]
Chronic renal failure	DISGG7K6	moderate	Genetic Variation	[15]
Colorectal carcinoma	DIS5PYL0	moderate	Biomarker	[16]
End-stage renal disease	DISXA7GG	moderate	Genetic Variation	[15]
Sarcoma	DISZDG3U	moderate	Biomarker	[17]
Soft tissue sarcoma	DISSN8XB	moderate	Biomarker	[17]
Tetralogy of fallot	DISMHFNW	moderate	Altered Expression	[18]
Urinary tract infection	DISMT6UV	moderate	Biomarker	[19]
Adrenocortical carcinoma	DISZF4HX	Limited	Biomarker	[20]
Aplasia cutis congenita	DISMDAYM	Limited	Biomarker	[20]
Corpus callosum, agenesis of	DISO9P40	Limited	Biomarker	[20]
Gastric cancer	DISXGOUK	Limited	Biomarker	[21]
Rectal carcinoma	DIS8FRR7	Limited	Biomarker	[22]
Stomach cancer	DISKIJSX	Limited	Biomarker	[21]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Coronin-7 (CORO7).	[23]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Coronin-7 (CORO7).	[26]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Coronin-7 (CORO7).	[28]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Coronin-7 (CORO7).	[31]

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Coronin-7 (CORO7).	[24]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Coronin-7 (CORO7).	[25]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Coronin-7 (CORO7).	[27]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Coronin-7 (CORO7).	[29]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Coronin-7 (CORO7).	[30]

References

• [1] Predictors of Successful Discharge of Patients on Postoperative Day 1 After Craniotomy for Brain Tumor.World Neurosurg. 2019 Jun;126:e869-e877. doi: 10.1016/j.wneu.2019.03.004. Epub 2019 Mar 9.
• [2] POD-1/TCF21 Reduces SHP Expression, Affecting LRH-1 Regulation and Cell Cycle Balance in Adrenocortical and Hepatocarcinoma Tumor Cells.Biomed Res Int. 2015;2015:841784. doi: 10.1155/2015/841784. Epub 2015 Sep 2.
• [3] Association between Early Acute Respiratory Distress Syndrome after Living-Donor Liver Transplantation and Perioperative Serum Biomarkers: The Role of Club Cell Protein 16.Biomed Res Int. 2019 Apr 11;2019:8958069. doi: 10.1155/2019/8958069. eCollection 2019.
• [4] Impact of epidural analgesia on the systemic biomarker response after hepatic resection.Oncotarget. 2019 Jan 15;10(5):584-594. doi: 10.18632/oncotarget.26549. eCollection 2019 Jan 15.
• [5] Vision Loss and Recovery after Baerveldt Aqueous Tube Shunt Implantation.J Ophthalmol. 2017;2017:4140305. doi: 10.1155/2017/4140305. Epub 2017 Jan 18.
• [6] Postoperative Interleukin-6 Predicts Intra-abdominal Septic Complications at an Early Stage After Elective Intestinal Operation for Crohn's Disease Patients.Inflamm Bowel Dis. 2018 Aug 16;24(9):1992-2000. doi: 10.1093/ibd/izy090.
• [7] Perioperative Dexmedetomidine Reduces Delirium in Elderly Patients after Lung Cancer Surgery.Psychiatr Danub. 2019 Mar;31(1):95-101. doi: 10.24869/psyd.2019.95.
• [8] Optimal Timing of Glucose Measurements After Total Joint Arthroplasty.J Arthroplasty. 2019 Jul;34(7S):S152-S158. doi: 10.1016/j.arth.2019.01.004. Epub 2019 Jan 9.
• [9] Primary hyperparathyroidism: Dynamic postoperative metabolic changes.Clin Endocrinol (Oxf). 2018 Jan;88(1):129-138. doi: 10.1111/cen.13476. Epub 2017 Oct 1.
• [10] Hypophosphatemia after Hepatectomy or Pancreatectomy: Role of the Nicotinamide Phosphoribosyltransferase.J Am Coll Surg. 2017 Oct;225(4):488-497.e2. doi: 10.1016/j.jamcollsurg.2017.06.012. Epub 2017 Jul 6.
• [11] The Effect of Adductor Canal Block on Knee Extensor Muscle Strength 6 Weeks After Total Knee Arthroplasty: A Randomized, Controlled Trial.Anesth Analg. 2018 Mar;126(3):1019-1027. doi: 10.1213/ANE.0000000000002338.
• [12] Genome-Wide Association Study Detected Novel Susceptibility Genes for Schizophrenia and Shared Trans-Populations/Diseases Genetic Effect.Schizophr Bull. 2019 Jun 18;45(4):824-834. doi: 10.1093/schbul/sby140.
• [13] Ability of Thromboelastography to Detect Hypercoagulability: A Systematic Review and Meta-Analysis.J Orthop Trauma. 2020 Jun;34(6):278-286. doi: 10.1097/BOT.0000000000001714.
• [14] Clinical utility of routine postoperative morning cortisol monitoring in detecting new hypothalamic-pituitary-adrenal axis insufficiency following endoscopic transsphenoidal surgery for sellar lesions.J Neurosurg. 2019 Mar 1;132(4):1054-1058. doi: 10.3171/2018.11.JNS182521.
• [15] Hepatic ischemia/reperfusion injury associates with acute kidney injury in liver transplantation: Prospective cohort study.Liver Transpl. 2017 May;23(5):634-644. doi: 10.1002/lt.24728.
• [16] Natural Killer Cell IFN Secretion is Profoundly Suppressed Following Colorectal Cancer Surgery.Ann Surg Oncol. 2018 Nov;25(12):3747-3754. doi: 10.1245/s10434-018-6691-3. Epub 2018 Sep 5.
• [17] Postoperative Day 1 Glucose May Be Associated With Wound Complications in Sarcomas Treated With Preoperative Radiation.Clin Orthop Relat Res. 2018 Mar;476(3):580-586. doi: 10.1007/s11999.0000000000000056.
• [18] Monitoring both procalcitonin and C-reactive protein in the early period after tetralogy of Fallot correction in children promotes rational antibiotic use.Adv Med Sci. 2018 Mar;63(1):112-118. doi: 10.1016/j.advms.2017.10.003. Epub 2017 Oct 27.
• [19] Outcomes of Early Removal of Urinary Catheter Following Rectal Resection for Cancer.Ann Surg Oncol. 2019 Jan;26(1):79-85. doi: 10.1245/s10434-018-6822-x. Epub 2018 Oct 23.
• [20] POD-1 binding to the E-box sequence inhibits SF-1 and StAR expression in human adrenocortical tumor cells.Mol Cell Endocrinol. 2013 May 22;371(1-2):140-7. doi: 10.1016/j.mce.2012.12.029. Epub 2013 Jan 9.
• [21] Safety of early oral feeding after total laparoscopic radical gastrectomy for gastric cancer (SOFTLY): Study protocol for a randomized controlled trial.Trials. 2019 Jun 26;20(1):384. doi: 10.1186/s13063-019-3493-2.
• [22] Monitoring perioperative serum albumin can identify anastomotic leakage in colorectal cancer patients with curative intent.Asian J Surg. 2018 Jan;41(1):30-38. doi: 10.1016/j.asjsur.2016.07.009. Epub 2016 Jul 19.
• [23] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [24] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [25] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [26] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [27] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [28] Effect of aflatoxin B(1), benzo[a]pyrene, and methapyrilene on transcriptomic and epigenetic alterations in human liver HepaRG cells. Food Chem Toxicol. 2018 Nov;121:214-223. doi: 10.1016/j.fct.2018.08.034. Epub 2018 Aug 26.
• [29] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [30] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [31] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.