Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTGGW2EF)

• DOT Name: Testis-specific Y-encoded-like protein 2 (TSPYL2)
• Synonyms: TSPY-like protein 2; Cell division autoantigen 1; Cutaneous T-cell lymphoma-associated antigen se20-4; CTCL-associated antigen se20-4; Differentially-expressed nucleolar TGF-beta1 target protein; Nuclear protein of 79 kDa; NP79
• Gene Name: TSPYL2
• Related Disease:
  Mycoses
  Renal fibrosis
  Abdominal aortic aneurysm
  Adenoma
  Advanced cancer
  Alpha thalassemia
  Anaplastic large cell lymphoma
  Aortic aneurysm
  B-cell neoplasm
  Barrett esophagus
  Classic Hodgkin lymphoma
  Congenital anemia
  Diabetic kidney disease
  Erythema multiforme
  Exfoliative dermatitis
  Hemoglobin H disease
  Hepatocellular carcinoma
  Lung cancer
  Lung carcinoma
  Lymphoid system disorder
  Mycosis fungoides
  Neoplasm
  Primary cutaneous peripheral T-cell lymphoma not otherwise specified
  Primary cutaneous T-cell lymphoma
  Sweetener
  Synovial sarcoma
  Tetralogy of fallot
  Type-1/2 diabetes
  Uterine fibroids
  Congenital dyserythropoietic anemia
  Intellectual disability
  Sezary syndrome
  Diphtheria
  Endometrial carcinoma
  Endometrium neoplasm
  Lymphoma
  Neuroblastoma
  Neurodevelopmental disorder
  T-cell lymphoma
• UniProt ID: TSYL2_HUMAN
• Pfam ID: PF00956
• Sequence:
  MDRPDEGPPAKTRRLSSSESPQRDPPPPPPPPPLLRLPLPPPQQRPRLQEETEAAQVLAD
  MRGVGLGPALPPPPPYVILEEGGIRAYFTLGAECPGWDSTIESGYGEAPPPTESLEALPT
  PEASGGSLEIDFQVVQSSSFGGEGALETCSAVGWAPQRLVDPKSKEEAIIIVEDEDEDER
  ESMRSSRRRRRRRRRKQRKVKRESRERNAERMESILQALEDIQLDLEAVNIKAGKAFLRL
  KRKFIQMRRPFLERRDLIIQHIPGFWVKAFLNHPRISILINRRDEDIFRYLTNLQVQDLR
  HISMGYKMKLYFQTNPYFTNMVIVKEFQRNRSGRLVSHSTPIRWHRGQEPQARRHGNQDA
  SHSFFSWFSNHSLPEADRIAEIIKNDLWVNPLRYYLRERGSRIKRKKQEMKKRKTRGRCE
  VVIMEDAPDYYAVEDIFSEISDIDETIHDIKISDFMETTDYFETTDNEITDINENICDSE
  NPDHNEVPNNETTDNNESADDHETTDNNESADDNNENPEDNNKNTDDNEENPNNNENTYG
  NNFFKGGFWGSHGNNQDSSDSDNEADEASDDEDNDGNEGDNEGSDDDGNEGDNEGSDDDD
  RDIEYYEKVIEDFDKDQADYEDVIEIISDESVEEEGIEEGIQQDEDIYEEGNYEEEGSED
  VWEEGEDSDDSDLEDVLQVPNGWANPGKRGKTG
• Function: Part of the CASK/TBR1/TSPYL2 transcriptional complex which modulates gene expression in response to neuronal synaptic activity, probably by facilitating nucleosome assembly. May inhibit cell proliferation by inducing p53-dependent CDKN1A expression.
• Tissue Specificity: Ubiquitously expressed, with highest levels in brain, testis and heart, and lowest levels in liver and pancreas.
• Reactome Pathway: XBP1(S) activates chaperone genes (R-HSA-381038)

Molecular Interaction Atlas (MIA) of This DOT

39 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Mycoses	DIS9K7PB	Definitive	Biomarker	[1]
Renal fibrosis	DISMHI3I	Definitive	Biomarker	[2]
Abdominal aortic aneurysm	DISD06OF	Strong	Altered Expression	[3]
Adenoma	DIS78ZEV	Strong	Altered Expression	[4]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[5]
Alpha thalassemia	DIS5XGK0	Strong	Altered Expression	[6]
Anaplastic large cell lymphoma	DISP4D1R	Strong	Biomarker	[7]
Aortic aneurysm	DISQ5KRA	Strong	Biomarker	[3]
B-cell neoplasm	DISVY326	Strong	Biomarker	[8]
Barrett esophagus	DIS416Y7	Strong	Genetic Variation	[9]
Classic Hodgkin lymphoma	DISV1LU6	Strong	Biomarker	[10]
Congenital anemia	DISTW0J6	Strong	Biomarker	[6]
Diabetic kidney disease	DISJMWEY	Strong	Biomarker	[2]
Erythema multiforme	DISKCLM1	Strong	Biomarker	[11]
Exfoliative dermatitis	DISQEWIW	Strong	Genetic Variation	[12]
Hemoglobin H disease	DISHFWO5	Strong	Altered Expression	[6]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[13]
Lung cancer	DISCM4YA	Strong	Biomarker	[4]
Lung carcinoma	DISTR26C	Strong	Biomarker	[4]
Lymphoid system disorder	DIS20IIA	Strong	Biomarker	[14]
Mycosis fungoides	DIS62RB8	Strong	Biomarker	[8]
Neoplasm	DISZKGEW	Strong	Biomarker	[15]
Primary cutaneous peripheral T-cell lymphoma not otherwise specified	DIS5OHQF	Strong	Biomarker	[16]
Primary cutaneous T-cell lymphoma	DIS35WVW	Strong	Genetic Variation	[17]
Sweetener	DISDGALM	Strong	Genetic Variation	[18]
Synovial sarcoma	DISEZJS7	Strong	Genetic Variation	[18]
Tetralogy of fallot	DISMHFNW	Strong	Altered Expression	[19]
Type-1/2 diabetes	DISIUHAP	Strong	Biomarker	[3]
Uterine fibroids	DISBZRMJ	Strong	Biomarker	[20]
Congenital dyserythropoietic anemia	DIS6FAT6	moderate	Biomarker	[21]
Intellectual disability	DISMBNXP	Disputed	Genetic Variation	[22]
Sezary syndrome	DISFMTC7	Disputed	Genetic Variation	[18]
Diphtheria	DISZWM55	Limited	Biomarker	[23]
Endometrial carcinoma	DISXR5CY	Limited	Biomarker	[24]
Endometrium neoplasm	DIS6OS2L	Limited	Biomarker	[24]
Lymphoma	DISN6V4S	Limited	Biomarker	[25]
Neuroblastoma	DISVZBI4	Limited	Biomarker	[26]
Neurodevelopmental disorder	DIS372XH	Limited	Genetic Variation	[26]
T-cell lymphoma	DISSXRTQ	Limited	Genetic Variation	[8]

12 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Testis-specific Y-encoded-like protein 2 (TSPYL2).	[27]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Testis-specific Y-encoded-like protein 2 (TSPYL2).	[28]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Testis-specific Y-encoded-like protein 2 (TSPYL2).	[29]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Testis-specific Y-encoded-like protein 2 (TSPYL2).	[30]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Testis-specific Y-encoded-like protein 2 (TSPYL2).	[31]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Testis-specific Y-encoded-like protein 2 (TSPYL2).	[32]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Testis-specific Y-encoded-like protein 2 (TSPYL2).	[33]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Testis-specific Y-encoded-like protein 2 (TSPYL2).	[34]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Testis-specific Y-encoded-like protein 2 (TSPYL2).	[35]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Testis-specific Y-encoded-like protein 2 (TSPYL2).	[38]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Testis-specific Y-encoded-like protein 2 (TSPYL2).	[39]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Testis-specific Y-encoded-like protein 2 (TSPYL2).	[40]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Testis-specific Y-encoded-like protein 2 (TSPYL2).	[36]
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Testis-specific Y-encoded-like protein 2 (TSPYL2).	[37]

References

• [1] Cryptococcus neoformans Cda1 and Its Chitin Deacetylase Activity Are Required for Fungal Pathogenesis.mBio. 2018 Nov 20;9(6):e02087-18. doi: 10.1128/mBio.02087-18.
• [2] Targeting the CDA1/CDA1BP1 Axis Retards Renal Fibrosis in Experimental Diabetic Nephropathy.Diabetes. 2019 Feb;68(2):395-408. doi: 10.2337/db18-0712. Epub 2018 Nov 13.
• [3] Diabetes Reduces Severity of Aortic Aneurysms Depending on the Presence of Cell Division Autoantigen 1 (CDA1).Diabetes. 2018 Apr;67(4):755-768. doi: 10.2337/db17-0134. Epub 2018 Jan 8.
• [4] Differentially expressed nucleolar TGF-beta1 target (DENTT) shows tissue-specific nuclear and cytoplasmic localization and increases TGF-beta1-responsive transcription in primates.Biochim Biophys Acta. 2005 May 1;1728(3):163-80. doi: 10.1016/j.bbaexp.2005.02.010. Epub 2005 Mar 22.
• [5] Synthesis and Investigation of Therapeutic Potential of Isoform-Specific HDAC8 Inhibitors for the Treatment of Cutaneous T Cell Lymphoma.Anticancer Agents Med Chem. 2019;19(7):916-934. doi: 10.2174/1871520619666190301150254.
• [6] A novel case of haemoglobin H disease associated with clinical and morphological characteristics of congenital dyserythropoietic anaemia type I.Eur J Haematol. 2002 Apr;68(4):247-52. doi: 10.1034/j.1600-0609.2002.01590.x.
• [7] Interleukin-2 receptor-directed therapies for cutaneous lymphomas.Hematol Oncol Clin North Am. 2003 Dec;17(6):1449-58. doi: 10.1016/s0889-8588(03)00110-2.
• [8] Primary cutaneous non-Hodgkin lymphoma: results of a retrospective analysis in the light of the recent ILROG guidelines.Tumori. 2018 Oct;104(5):394-400. doi: 10.5301/tj.5000606. Epub 2018 May 8.
• [9] Haplotypes of the IL-1 gene cluster are associated with gastroesophageal reflux disease and Barrett's esophagus.Hum Immunol. 2013 Sep;74(9):1161-9. doi: 10.1016/j.humimm.2013.06.026. Epub 2013 Jun 24.
• [10] Apoptosis Induction and Gene Expression Profile Alterations of Cutaneous T-Cell Lymphoma Cells following Their Exposure to Bortezomib and Methotrexate.PLoS One. 2017 Jan 20;12(1):e0170186. doi: 10.1371/journal.pone.0170186. eCollection 2017.
• [11] Erythema multiforme-like lesions in primary cutaneous aggressive cytotoxic epidermotropic CD8+ T-cell lymphoma: A diagnostic and therapeutic challenge.J Cutan Pathol. 2017 Oct;44(10):867-873. doi: 10.1111/cup.12995. Epub 2017 Jul 19.
• [12] Association of erythrodermic cutaneous T-cell lymphoma, superantigen-positive Staphylococcus aureus, and oligoclonal T-cell receptor V beta gene expansion.Blood. 1997 Jan 1;89(1):32-40.
• [13] The X-linked tumor suppressor TSPX interacts and promotes degradation of the hepatitis B viral protein HBx via the proteasome pathway.PLoS One. 2011;6(7):e22979. doi: 10.1371/journal.pone.0022979. Epub 2011 Jul 29.
• [14] Hydroa-like cutaneous T-cell lymphoma: a clinicopathologic and molecular genetic study of 16 pediatric cases from Peru.Appl Immunohistochem Mol Morphol. 2002 Mar;10(1):7-14. doi: 10.1097/00129039-200203000-00002.
• [15] Battle of the sexes: contrasting roles of testis-specific protein Y-encoded (TSPY) and TSPX in human oncogenesis.Asian J Androl. 2019 May-Jun;21(3):260-269. doi: 10.4103/aja.aja_43_18.
• [16] Electrocardiographic studies of romidepsin demonstrate its safety and identify a potential role for K(ATP) channel.Clin Cancer Res. 2013 Jun 1;19(11):3095-104. doi: 10.1158/1078-0432.CCR-13-0109. Epub 2013 Apr 15.
• [17] A new protoparvovirus in human fecal samples and cutaneous T cell lymphomas (mycosis fungoides).Virology. 2016 Sep;496:299-305. doi: 10.1016/j.virol.2016.06.013. Epub 2016 Jul 7.
• [18] Gene expression profiling and immune cell-type deconvolution highlight robust disease progression and survival markers in multiple cohorts of CTCL patients.Oncoimmunology. 2018 May 31;7(8):e1467856. doi: 10.1080/2162402X.2018.1467856. eCollection 2018.
• [19] Isolation of differentially expressed genes in human heart tissues.Biochim Biophys Acta. 2002 Dec 12;1588(3):241-6. doi: 10.1016/s0925-4439(02)00171-0.
• [20] Potential mechanisms of aberrant DNA hypomethylation on the x chromosome in uterine leiomyomas.J Reprod Dev. 2014 Mar 7;60(1):47-54. doi: 10.1262/jrd.2013-095. Epub 2013 Nov 29.
• [21] Congenital dyserythropoietic anemias.Curr Opin Hematol. 2011 May;18(3):146-51. doi: 10.1097/MOH.0b013e32834521b0.
• [22] Identification of a homozygous missense mutation in LRP2 and a hemizygous missense mutation in TSPYL2 in a family with mild intellectual disability.Psychiatr Genet. 2016 Apr;26(2):66-73. doi: 10.1097/YPG.0000000000000114.
• [23] Modified DT-IL2 fusion toxin targeting uniquely IL2Ralpha expressing leukemia cell lines - Construction and characterization.J Biotechnol. 2010 Jul 20;148(2-3):147-55. doi: 10.1016/j.jbiotec.2010.04.006. Epub 2010 May 24.
• [24] Exome sequencing of serous endometrial tumors identifies recurrent somatic mutations in chromatin-remodeling and ubiquitin ligase complex genes.Nat Genet. 2012 Dec;44(12):1310-5. doi: 10.1038/ng.2455. Epub 2012 Oct 28.
• [25] Cytogenetic findings in cell lines from cutaneous T-cell lymphoma.Dermatol Clin. 1994 Apr;12(2):295-304.
• [26] TSPYL2 Regulates the Expression of EZH2 Target Genes in Neurons.Mol Neurobiol. 2019 Apr;56(4):2640-2652. doi: 10.1007/s12035-018-1238-y. Epub 2018 Jul 26.
• [27] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [28] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [29] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [30] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [31] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [32] Gene expression profile induced by arsenic trioxide in chronic lymphocytic leukemia cells reveals a central role for heme oxygenase-1 in apoptosis and regulation of matrix metalloproteinase-9. Oncotarget. 2016 Dec 13;7(50):83359-83377.
• [33] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [34] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [35] Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
• [36] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [37] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [38] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [39] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [40] Identification of gene markers for formaldehyde exposure in humans. Environ Health Perspect. 2007 Oct;115(10):1460-6. doi: 10.1289/ehp.10180.