Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTHFZ8ED)

• DOT Name: Heat shock protein beta-1 (HSPB1)
• Synonyms: HspB1; 28 kDa heat shock protein; Estrogen-regulated 24 kDa protein; Heat shock 27 kDa protein; HSP 27; Stress-responsive protein 27; SRP27
• Gene Name: HSPB1
• Related Disease:
  Charcot-Marie-Tooth disease axonal type 2F
  Neuronopathy, distal hereditary motor, type 2B
  Distal hereditary motor neuropathy type 2
• UniProt ID: HSPB1_HUMAN
• PDB ID: 2N3J; 3Q9P; 3Q9Q; 4MJH; 6DV5; 6GJH
• Pfam ID: PF00011
• Sequence:
  MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPP
  AAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEI
  TGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEIT
  IPVTFESRAQLGGPEAAKSDETAAK
• Function: Small heat shock protein which functions as a molecular chaperone probably maintaining denatured proteins in a folding-competent state. Plays a role in stress resistance and actin organization. Through its molecular chaperone activity may regulate numerous biological processes including the phosphorylation and the axonal transport of neurofilament proteins.
• Tissue Specificity: Detected in all tissues tested: skeletal muscle, heart, aorta, large intestine, small intestine, stomach, esophagus, bladder, adrenal gland, thyroid, pancreas, testis, adipose tissue, kidney, liver, spleen, cerebral cortex, blood serum and cerebrospinal fluid. Highest levels are found in the heart and in tissues composed of striated and smooth muscle.
• KEGG Pathway:
  MAPK sig.ling pathway (hsa04010)
  VEGF sig.ling pathway (hsa04370)
  Amoebiasis (hsa05146)
• Reactome Pathway:
  AUF1 (hnRNP D0) binds and destabilizes mRNA (R-HSA-450408)
  MAPK6/MAPK4 signaling (R-HSA-5687128)
  Extra-nuclear estrogen signaling (R-HSA-9009391)
  VEGFA-VEGFR2 Pathway (R-HSA-4420097)

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Charcot-Marie-Tooth disease axonal type 2F	DIS4U2DX	Definitive	Autosomal dominant	[1]
Neuronopathy, distal hereditary motor, type 2B	DISG69P9	Moderate	Autosomal dominant	[2]
Distal hereditary motor neuropathy type 2	DIS162V1	Supportive	Autosomal dominant	[3]

This DOT Affected the Drug Response of 6 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Quercetin	DM3NC4M	Approved	Heat shock protein beta-1 (HSPB1) increases the response to substance of Quercetin.	[53]
Temozolomide	DMKECZD	Approved	Heat shock protein beta-1 (HSPB1) increases the response to substance of Temozolomide.	[53]
Fluorouracil	DMUM7HZ	Approved	Heat shock protein beta-1 (HSPB1) decreases the response to substance of Fluorouracil.	[54]
Dexamethasone	DMMWZET	Approved	Heat shock protein beta-1 (HSPB1) decreases the response to substance of Dexamethasone.	[55]
Bortezomib	DMNO38U	Approved	Heat shock protein beta-1 (HSPB1) decreases the response to substance of Bortezomib.	[56]
PEITC	DMOMN31	Phase 2	Heat shock protein beta-1 (HSPB1) affects the binding of PEITC.	[57]

44 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Heat shock protein beta-1 (HSPB1).	[4]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Heat shock protein beta-1 (HSPB1).	[5]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Heat shock protein beta-1 (HSPB1).	[6]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Heat shock protein beta-1 (HSPB1).	[7]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Heat shock protein beta-1 (HSPB1).	[8]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Heat shock protein beta-1 (HSPB1).	[9]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Heat shock protein beta-1 (HSPB1).	[10]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Heat shock protein beta-1 (HSPB1).	[11]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Heat shock protein beta-1 (HSPB1).	[12]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Heat shock protein beta-1 (HSPB1).	[13]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Heat shock protein beta-1 (HSPB1).	[14]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Heat shock protein beta-1 (HSPB1).	[15]
Marinol	DM70IK5	Approved	Marinol increases the expression of Heat shock protein beta-1 (HSPB1).	[16]
Selenium	DM25CGV	Approved	Selenium increases the expression of Heat shock protein beta-1 (HSPB1).	[17]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Heat shock protein beta-1 (HSPB1).	[18]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Heat shock protein beta-1 (HSPB1).	[19]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone affects the expression of Heat shock protein beta-1 (HSPB1).	[20]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of Heat shock protein beta-1 (HSPB1).	[21]
Acetic Acid, Glacial	DM4SJ5Y	Approved	Acetic Acid, Glacial increases the expression of Heat shock protein beta-1 (HSPB1).	[22]
Motexafin gadolinium	DMEJKRF	Approved	Motexafin gadolinium increases the expression of Heat shock protein beta-1 (HSPB1).	[22]
Imatinib	DM7RJXL	Approved	Imatinib increases the expression of Heat shock protein beta-1 (HSPB1).	[23]
Gallium nitrate	DMF9O6B	Approved	Gallium nitrate decreases the expression of Heat shock protein beta-1 (HSPB1).	[25]
Thiopental	DMGP8AX	Approved	Thiopental increases the expression of Heat shock protein beta-1 (HSPB1).	[26]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Heat shock protein beta-1 (HSPB1).	[27]
Guaiacol	DMN4E7T	Phase 3	Guaiacol increases the expression of Heat shock protein beta-1 (HSPB1).	[28]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Heat shock protein beta-1 (HSPB1).	[17]
Afimoxifene	DMFORDT	Phase 2	Afimoxifene increases the expression of Heat shock protein beta-1 (HSPB1).	[10]
Puerarin	DMJIMXH	Phase 2	Puerarin increases the expression of Heat shock protein beta-1 (HSPB1).	[28]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Heat shock protein beta-1 (HSPB1).	[31]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Heat shock protein beta-1 (HSPB1).	[32]
TAK-114	DMTXE19	Phase 1	TAK-114 increases the expression of Heat shock protein beta-1 (HSPB1).	[35]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Heat shock protein beta-1 (HSPB1).	[36]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the expression of Heat shock protein beta-1 (HSPB1).	[37]
Undecylenic acid derivative 1	DMLJ2HE	Patented	Undecylenic acid derivative 1 increases the expression of Heat shock protein beta-1 (HSPB1).	[38]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Heat shock protein beta-1 (HSPB1).	[40]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Heat shock protein beta-1 (HSPB1).	[41]
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of Heat shock protein beta-1 (HSPB1).	[42]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A decreases the expression of Heat shock protein beta-1 (HSPB1).	[43]
Paraquat	DMR8O3X	Investigative	Paraquat decreases the expression of Heat shock protein beta-1 (HSPB1).	[44]
Phencyclidine	DMQBEYX	Investigative	Phencyclidine increases the expression of Heat shock protein beta-1 (HSPB1).	[46]
[3H]methyltrienolone	DMTSGOW	Investigative	[3H]methyltrienolone increases the expression of Heat shock protein beta-1 (HSPB1).	[47]
Okadaic acid	DM47CO1	Investigative	Okadaic acid decreases the expression of Heat shock protein beta-1 (HSPB1).	[48]
15-deoxy-Delta(12, 14)-prostaglandin J(2)	DM8VUX3	Investigative	15-deoxy-Delta(12, 14)-prostaglandin J(2) decreases the expression of Heat shock protein beta-1 (HSPB1).	[51]
Chlorogenic acid	DM2Y3P4	Investigative	Chlorogenic acid increases the expression of Heat shock protein beta-1 (HSPB1).	[28]

7 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Dihydroxyacetone	DMM1LG2	Approved	Dihydroxyacetone increases the phosphorylation of Heat shock protein beta-1 (HSPB1).	[24]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the phosphorylation of Heat shock protein beta-1 (HSPB1).	[30]
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Heat shock protein beta-1 (HSPB1).	[33]
Mivebresib	DMCPF90	Phase 1	Mivebresib decreases the phosphorylation of Heat shock protein beta-1 (HSPB1).	[34]
SB 203580	DMAET6F	Terminated	SB 203580 decreases the phosphorylation of Heat shock protein beta-1 (HSPB1).	[39]
Microcystin-LR	DMTMLRN	Investigative	Microcystin-LR increases the phosphorylation of Heat shock protein beta-1 (HSPB1).	[49]
	DM9CEI5		increases the phosphorylation of Heat shock protein beta-1 (HSPB1).	[50]

3 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
DNCB	DMDTVYC	Phase 2	DNCB affects the binding of Heat shock protein beta-1 (HSPB1).	[29]
D-glucose	DMMG2TO	Investigative	D-glucose increases the secretion of Heat shock protein beta-1 (HSPB1).	[45]
methylglyoxal	DMRC3OZ	Investigative	methylglyoxal affects the binding of Heat shock protein beta-1 (HSPB1).	[52]

References

• [1] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [2] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [3] Mutant small heat-shock protein 27 causes axonal Charcot-Marie-Tooth disease and distal hereditary motor neuropathy. Nat Genet. 2004 Jun;36(6):602-6. doi: 10.1038/ng1354. Epub 2004 May 2.
• [4] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [5] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [6] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [7] Inhibition of heat shock proteins (HSP) expression by quercetin and differential doxorubicin sensitization in neuroblastoma and Ewing's sarcoma cell lines. J Neurochem. 2007 Nov;103(4):1344-54. doi: 10.1111/j.1471-4159.2007.04835.x. Epub 2007 Aug 6.
• [8] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [9] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [10] Transcriptional activation of heat shock protein 27 gene expression by 17beta-estradiol and modulation by antiestrogens and aryl hydrocarbon receptor agonists. J Mol Endocrinol. 2001 Feb;26(1):31-42. doi: 10.1677/jme.0.0260031.
• [11] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [12] Role of NADPH oxidase in arsenic-induced reactive oxygen species formation and cytotoxicity in myeloid leukemia cells. Proc Natl Acad Sci U S A. 2004 Mar 30;101(13):4578-83.
• [13] MS4A3-HSP27 target pathway reveals potential for haematopoietic disorder treatment in alimentary toxic aleukia. Cell Biol Toxicol. 2023 Feb;39(1):201-216. doi: 10.1007/s10565-021-09639-4. Epub 2021 Sep 28.
• [14] Proteomic analysis of liver cancer cells treated with suberonylanilide hydroxamic acid. Cancer Chemother Pharmacol. 2008 Apr;61(5):791-802.
• [15] Inflammation in methotrexate-induced pulmonary toxicity occurs via the p38 MAPK pathway. Toxicology. 2009 Feb 27;256(3):183-90. doi: 10.1016/j.tox.2008.11.016. Epub 2008 Nov 28.
• [16] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [17] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [18] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [19] Gingival Stromal Cells as an In Vitro Model: Cannabidiol Modulates Genes Linked With Amyotrophic Lateral Sclerosis. J Cell Biochem. 2017 Apr;118(4):819-828. doi: 10.1002/jcb.25757. Epub 2016 Nov 28.
• [20] Proteomic analysis of human adipose tissue after rosiglitazone treatment shows coordinated changes to promote glucose uptake. Obesity (Silver Spring). 2010 Jan;18(1):27-34. doi: 10.1038/oby.2009.208. Epub 2009 Jun 25.
• [21] Heavy metals chromium and neodymium reduced phosphorylation level of heat shock protein 27 in human keratinocytes. Toxicol In Vitro. 2010 Jun;24(4):1098-104. doi: 10.1016/j.tiv.2010.03.011. Epub 2010 Mar 21.
• [22] Motexafin gadolinium and zinc induce oxidative stress responses and apoptosis in B-cell lymphoma lines. Cancer Res. 2005 Dec 15;65(24):11676-88.
• [23] Effects of Imatinib Mesylate (Gleevec) on human islet NF-kappaB activation and chemokine production in vitro. PLoS One. 2011;6(9):e24831. doi: 10.1371/journal.pone.0024831. Epub 2011 Sep 14.
• [24] The sunless tanning agent dihydroxyacetone induces stress response gene expression and signaling in cultured human keratinocytes and reconstructed epidermis. Redox Biol. 2020 Sep;36:101594. doi: 10.1016/j.redox.2020.101594. Epub 2020 May 29.
• [25] Role of oxidative stress in the induction of metallothionein-2A and heme oxygenase-1 gene expression by the antineoplastic agent gallium nitrate in human lymphoma cells. Free Radic Biol Med. 2008 Sep 15;45(6):763-72.
• [26] Thiopental protects human T lymphocytes from apoptosis in vitro via the expression of heat shock protein 70. J Pharmacol Exp Ther. 2008 Apr;325(1):217-25. doi: 10.1124/jpet.107.133108. Epub 2008 Jan 24.
• [27] Differential regulation of proliferation, cell cycle control and gene expression in cultured human aortic and pulmonary artery endothelial cells by resveratrol. Int J Mol Med. 2010 Nov;26(5):743-9.
• [28] Examining the genomic influence of skin antioxidants in vitro. Mediators Inflamm. 2010;2010.
• [29] Proteomic analysis of the cellular response to a potent sensitiser unveils the dynamics of haptenation in living cells. Toxicology. 2020 Dec 1;445:152603. doi: 10.1016/j.tox.2020.152603. Epub 2020 Sep 28.
• [30] Cytokines and growth factors induce HSP27 phosphorylation in human astrocytes. J Neuropathol Exp Neurol. 1995 Jul;54(4):504-12. doi: 10.1097/00005072-199507000-00004.
• [31] Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.
• [32] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [33] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [34] Superior efficacy of cotreatment with BET protein inhibitor and BCL2 or MCL1 inhibitor against AML blast progenitor cells. Blood Cancer J. 2019 Jan 15;9(2):4. doi: 10.1038/s41408-018-0165-5.
• [35] Methylisoindigo preferentially kills cancer stem cells by interfering cell metabolism via inhibition of LKB1 and activation of AMPK in PDACs. Mol Oncol. 2016 Jun;10(6):806-24. doi: 10.1016/j.molonc.2016.01.008. Epub 2016 Feb 4.
• [36] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [37] Comparative proteomics reveals concordant and discordant biochemical effects of caffeine versus epigallocatechin-3-gallate in human endothelial cells. Toxicol Appl Pharmacol. 2019 Sep 1;378:114621. doi: 10.1016/j.taap.2019.114621. Epub 2019 Jun 10.
• [38] Identification of potential biomarkers for predicting acute dermal irritation by proteomic analysis. J Appl Toxicol. 2011 Nov;31(8):762-72.
• [39] A novel cell permeant peptide inhibitor of MAPKAP kinase II inhibits intimal hyperplasia in a human saphenous vein organ culture model. J Vasc Surg. 2010 Dec;52(6):1596-607. doi: 10.1016/j.jvs.2010.06.168. Epub 2010 Sep 22.
• [40] Bisphenol-A and estradiol exert novel gene regulation in human MCF-7 derived breast cancer cells. Mol Cell Endocrinol. 2004 Jun 30;221(1-2):47-55. doi: 10.1016/j.mce.2004.04.010.
• [41] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [42] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [43] Comparative mechanisms of zearalenone and ochratoxin A toxicities on cultured HepG2 cells: is oxidative stress a common process?. Environ Toxicol. 2009 Dec;24(6):538-48. doi: 10.1002/tox.20449.
• [44] Cytotoxicity and gene array analysis of alveolar epithelial A549 cells exposed to paraquat. Chem Biol Interact. 2010 Dec 5;188(3):427-36.
• [45] Calorie restriction-induced changes in the secretome of human adipocytes, comparison with resveratrol-induced secretome effects. Biochim Biophys Acta. 2014 Sep;1844(9):1511-22. doi: 10.1016/j.bbapap.2014.04.023. Epub 2014 May 5.
• [46] Microarray Analysis of Gene Expression Alteration in Human Middle Ear Epithelial Cells Induced by Asian Sand Dust. Clin Exp Otorhinolaryngol. 2015 Dec;8(4):345-53. doi: 10.3342/ceo.2015.8.4.345. Epub 2015 Nov 10.
• [47] Evaluation of an in vitro model of androgen ablation and identification of the androgen responsive proteome in LNCaP cells. Proteomics. 2007 Jan;7(1):47-63.
• [48] Proteomic analysis reveals multiple patterns of response in cells exposed to a toxin mixture. Chem Res Toxicol. 2009 Jun;22(6):1077-85.
• [49] Protein phosphatase 2A inhibition and subsequent cytoskeleton reorganization contributes to cell migration caused by microcystin-LR in human laryngeal epithelial cells (Hep-2). Environ Toxicol. 2017 Mar;32(3):890-903. doi: 10.1002/tox.22289. Epub 2016 Jul 9.
• [50] A novel sialyltransferase inhibitor suppresses FAK/paxillin signaling and cancer angiogenesis and metastasis pathways. Cancer Res. 2011 Jan 15;71(2):473-83. doi: 10.1158/0008-5472.CAN-10-1303. Epub 2011 Jan 11.
• [51] Inhibition of nuclear translocation of nuclear factor-kappaB despite lack of functional IkappaBalpha protein overcomes multiple defects in apoptosis signaling in human B-cell malignancies. Clin Cancer Res. 2005 Nov 15;11(22):8186-94. doi: 10.1158/1078-0432.CCR-05-0224.
• [52] GLO1 overexpression in human malignant melanoma. Melanoma Res. 2010 Apr;20(2):85-96. doi: 10.1097/CMR.0b013e3283364903.
• [53] Silencing of Hsp27 and Hsp72 in glioma cells as a tool for programmed cell death induction upon temozolomide and quercetin treatment. Toxicol Appl Pharmacol. 2013 Dec 15;273(3):580-9. doi: 10.1016/j.taap.2013.10.003. Epub 2013 Oct 12.
• [54] Heat shock protein 27, a novel regulator of 5-fluorouracil resistance in colon cancer. Oncol Rep. 2008 Nov;20(5):1165-72.
• [55] Hsp27 inhibits release of mitochondrial protein Smac in multiple myeloma cells and confers dexamethasone resistance. Blood. 2003 Nov 1;102(9):3379-86. doi: 10.1182/blood-2003-05-1417. Epub 2003 Jul 10.
• [56] Blockade of Hsp27 overcomes Bortezomib/proteasome inhibitor PS-341 resistance in lymphoma cells. Cancer Res. 2003 Oct 1;63(19):6174-7.
• [57] Identification of potential protein targets of isothiocyanates by proteomics. Chem Res Toxicol. 2011 Oct 17;24(10):1735-43. doi: 10.1021/tx2002806. Epub 2011 Aug 26.