General Information of Drug Off-Target (DOT) (ID: OTHJNNO2)

DOT Name T-cell activation Rho GTPase-activating protein (TAGAP)
Synonyms T-cell activation GTPase-activating protein
Gene Name TAGAP
Related Disease
Autoimmune disease ( )
Candidemia ( )
Cowden disease ( )
Crohn disease ( )
Multiple sclerosis ( )
Nervous system inflammation ( )
Palmoplantar pustulosis ( )
Psoriasis ( )
Rheumatoid arthritis ( )
Ulcerative colitis ( )
Asthma ( )
Coeliac disease ( )
Immune system disorder ( )
Arthritis ( )
Inflammation ( )
Type-1 diabetes ( )
UniProt ID
TAGAP_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00620
Sequence
MKLRSSHNASKTLNANNMETLIECQSEGDIKEHPLLASCESEDSICQLIEVKKRKKVLSW
PFLMRRLSPASDFSGALETDLKASLFDQPLSIICGDSDTLPRPIQDILTILCLKGPSTEG
IFRRAANEKARKELKEELNSGDAVDLERLPVHLLAVVFKDFLRSIPRKLLSSDLFEEWMG
ALEMQDEEDRIEALKQVADKLPRPNLLLLKHLVYVLHLISKNSEVNRMDSSNLAICIGPN
MLTLENDQSLSFEAQKDLNNKVKTLVEFLIDNCFEIFGENIPVHSSITSDDSLEHTDSSD
VSTLQNDSAYDSNDPDVESNSSSGISSPSRQPQVPMATAAGLDSAGPQDAREVSPEPIVS
TVARLKSSLAQPDRRYSEPSMPSSQECLESRVTNQTLTKSEGDFPVPRVGSRLESEEAED
PFPEEVFPAVQGKTKRPVDLKIKNLAPGSVLPRALVLKAFSSSSLDASSDSSPVASPSSP
KRNFFSRHQSFTTKTEKGKPSREIKKHSMSFTFAPHKKVLTKNLSAGSGKSQDFTRDHVP
RGVRKESQLAGRIVQENGCETHNQTARGFCLRPHALSVDDVFQGADWERPGSPPSYEEAM
QGPAARLVASESQTVGSMTVGSMRARMLEAHCLLPPLPPAHHVEDSRHRGSKEPLPGHGL
SPLPERWKQSRTVHASGDSLGHVSGPGRPELLPLRTVSESVQRNKRDCLVRRCSQPVFEA
DQFQYAKESYI
Function May function as a GTPase-activating protein and may play important roles during T-cell activation.
Reactome Pathway
CDC42 GTPase cycle (R-HSA-9013148 )
RAC1 GTPase cycle (R-HSA-9013149 )
RHOA GTPase cycle (R-HSA-8980692 )

Molecular Interaction Atlas (MIA) of This DOT

16 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Autoimmune disease DISORMTM Strong Genetic Variation [1]
Candidemia DISVKFN7 Strong Genetic Variation [2]
Cowden disease DISMYKCE Strong Altered Expression [3]
Crohn disease DIS2C5Q8 Strong Genetic Variation [3]
Multiple sclerosis DISB2WZI Strong Genetic Variation [4]
Nervous system inflammation DISB3X5A Strong Biomarker [5]
Palmoplantar pustulosis DISCNSWD Strong Biomarker [6]
Psoriasis DIS59VMN Strong Biomarker [5]
Rheumatoid arthritis DISTSB4J Strong Biomarker [7]
Ulcerative colitis DIS8K27O Strong Altered Expression [8]
Asthma DISW9QNS moderate Genetic Variation [9]
Coeliac disease DISIY60C moderate Biomarker [8]
Immune system disorder DISAEGPH moderate Genetic Variation [10]
Arthritis DIST1YEL Limited Altered Expression [7]
Inflammation DISJUQ5T Limited Biomarker [7]
Type-1 diabetes DIS7HLUB Limited Genetic Variation [11]
------------------------------------------------------------------------------------
⏷ Show the Full List of 16 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
9 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin increases the expression of T-cell activation Rho GTPase-activating protein (TAGAP). [12]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of T-cell activation Rho GTPase-activating protein (TAGAP). [13]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of T-cell activation Rho GTPase-activating protein (TAGAP). [14]
Arsenic DMTL2Y1 Approved Arsenic affects the expression of T-cell activation Rho GTPase-activating protein (TAGAP). [15]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of T-cell activation Rho GTPase-activating protein (TAGAP). [16]
Marinol DM70IK5 Approved Marinol increases the expression of T-cell activation Rho GTPase-activating protein (TAGAP). [17]
Acetic Acid, Glacial DM4SJ5Y Approved Acetic Acid, Glacial increases the expression of T-cell activation Rho GTPase-activating protein (TAGAP). [18]
Motexafin gadolinium DMEJKRF Approved Motexafin gadolinium increases the expression of T-cell activation Rho GTPase-activating protein (TAGAP). [18]
Diphenylpyraline DMW4X37 Approved Diphenylpyraline decreases the expression of T-cell activation Rho GTPase-activating protein (TAGAP). [19]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of T-cell activation Rho GTPase-activating protein (TAGAP). [20]
------------------------------------------------------------------------------------

References

1 Identification and in silico analysis of functional SNPs of human TAGAP protein: A comprehensive study.PLoS One. 2018 Jan 12;13(1):e0188143. doi: 10.1371/journal.pone.0188143. eCollection 2018.
2 Immunochip SNP array identifies novel genetic variants conferring susceptibility to candidaemia.Nat Commun. 2014 Sep 8;5:4675. doi: 10.1038/ncomms5675.
3 T-cell activation Rho GTPase-activating protein expression varies with inflammation location and severity in Crohn's disease.J Surg Res. 2014 Aug;190(2):457-64. doi: 10.1016/j.jss.2014.01.019. Epub 2014 Jan 17.
4 Association of rs1738074 polymorphism of TAGAP gene with susceptibility to multiple sclerosis in the Iranian population.Neurosci Lett. 2017 May 1;648:66-69. doi: 10.1016/j.neulet.2017.03.041. Epub 2017 Mar 27.
5 T-cell activation RhoGTPase-activating protein plays an important role in T(H)17-cell differentiation.Immunol Cell Biol. 2017 Sep;95(8):729-735. doi: 10.1038/icb.2017.27. Epub 2017 May 2.
6 Identification of 15 new psoriasis susceptibility loci highlights the role of innate immunity.Nat Genet. 2012 Dec;44(12):1341-8. doi: 10.1038/ng.2467. Epub 2012 Nov 11.
7 T cell activation Rho GTPase activating protein (TAGAP) is upregulated in clinical and experimental arthritis.Cytokine. 2018 Apr;104:130-135. doi: 10.1016/j.cyto.2017.10.002. Epub 2017 Oct 7.
8 Expression patterns common and unique to ulcerative colitis and celiac disease.Ann Hum Genet. 2019 Mar;83(2):86-94. doi: 10.1111/ahg.12293. Epub 2018 Nov 6.
9 Association between ORMDL3, IL1RL1 and a deletion on chromosome 17q21 with asthma risk in Australia.Eur J Hum Genet. 2011 Apr;19(4):458-64. doi: 10.1038/ejhg.2010.191. Epub 2010 Dec 8.
10 Meta-analysis of genome-wide association studies in celiac disease and rheumatoid arthritis identifies fourteen non-HLA shared loci.PLoS Genet. 2011 Feb;7(2):e1002004. doi: 10.1371/journal.pgen.1002004. Epub 2011 Feb 24.
11 Shared and distinct genetic variants in type 1 diabetes and celiac disease.N Engl J Med. 2008 Dec 25;359(26):2767-77. doi: 10.1056/NEJMoa0807917. Epub 2008 Dec 10.
12 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
13 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
14 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
15 Drinking-water arsenic exposure modulates gene expression in human lymphocytes from a U.S. population. Environ Health Perspect. 2008 Apr;116(4):524-31. doi: 10.1289/ehp.10861.
16 Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
17 Single-cell Transcriptome Mapping Identifies Common and Cell-type Specific Genes Affected by Acute Delta9-tetrahydrocannabinol in Humans. Sci Rep. 2020 Feb 26;10(1):3450. doi: 10.1038/s41598-020-59827-1.
18 Motexafin gadolinium and zinc induce oxidative stress responses and apoptosis in B-cell lymphoma lines. Cancer Res. 2005 Dec 15;65(24):11676-88.
19 Controlled diesel exhaust and allergen coexposure modulates microRNA and gene expression in humans: Effects on inflammatory lung markers. J Allergy Clin Immunol. 2016 Dec;138(6):1690-1700. doi: 10.1016/j.jaci.2016.02.038. Epub 2016 Apr 24.
20 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.