Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTILCLXA)

DOT Name Interleukin-9 receptor (IL9R)
Synonyms IL-9 receptor; IL-9R; CD antigen CD129
Gene Name IL9R
Related Disease
Adult lymphoma ( )
Advanced cancer ( )
Allergic asthma ( )
Alzheimer disease ( )
Alzheimer disease 3 ( )
Asthma ( )
Atopic dermatitis ( )
Autoimmune disease ( )
Cervical Intraepithelial neoplasia ( )
Chronic bronchitis ( )
Colitis ( )
Craniosynostosis ( )
Hepatitis ( )
Hepatocellular carcinoma ( )
Lung carcinoma ( )
Lymphoma ( )
Nasal polyp ( )
Neoplasm ( )
Parasitic infection ( )
Pediatric lymphoma ( )
Psoriasis ( )
Psoriatic arthritis ( )
Sarcoidosis ( )
Schizophrenia ( )
Melanoma ( )
Mood disorder ( )
Rheumatoid arthritis ( )
Eosinophilic esophagitis ( )
Nervous system inflammation ( )
UniProt ID
IL9R_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
7OX5
Sequence
MGLGRCIWEGWTLESEALRRDMGTWLLACICICTCVCLGVSVTGEGQGPRSRTFTCLTNN
ILRIDCHWSAPELGQGSSPWLLFTSNQAPGGTHKCILRGSECTVVLPPEAVLVPSDNFTI
TFHHCMSGREQVSLVDPEYLPRRHVKLDPPSDLQSNISSGHCILTWSISPALEPMTTLLS
YELAFKKQEEAWEQAQHRDHIVGVTWLILEAFELDPGFIHEARLRVQMATLEDDVVEEER
YTGQWSEWSQPVCFQAPQRQGPLIPPWGWPGNTLVAVSIFLLLTGPTYLLFKLSPRVKRI
FYQNVPSPAMFFQPLYSVHNGNFQTWMGAHGAGVLLSQDCAGTPQGALEPCVQEATALLT
CGPARPWKSVALEEEQEGPGTRLPGNLSSEDVLPAGCTEWRVQTLAYLPQEDWAPTSLTR
PAPPDSEGSRSSSSSSSSNNNNYCALGCYGGWHLSALPGNTQSSGPIPALACGLSCDHQG
LETQQGVAWVLAGHCQRPGLHEDLQGMLLPSVLSKARSWTF
Function Plays an important role in the immune response against parasites by acting as a receptor of IL9.
KEGG Pathway
Cytokine-cytokine receptor interaction (hsa04060 )
JAK-STAT sig.ling pathway (hsa04630 )
Hematopoietic cell lineage (hsa04640 )
Reactome Pathway
Interleukin-9 signaling (R-HSA-8985947 )

Molecular Interaction Atlas (MIA) of This DOT

29 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Adult lymphoma DISK8IZR Strong Altered Expression [1]
Advanced cancer DISAT1Z9 Strong Altered Expression [2]
Allergic asthma DISHF0H3 Strong Biomarker [3]
Alzheimer disease DISF8S70 Strong Altered Expression [4]
Alzheimer disease 3 DISVT69G Strong Altered Expression [4]
Asthma DISW9QNS Strong Biomarker [5]
Atopic dermatitis DISTCP41 Strong Altered Expression [4]
Autoimmune disease DISORMTM Strong Altered Expression [2]
Cervical Intraepithelial neoplasia DISXP757 Strong Biomarker [6]
Chronic bronchitis DISS8O8V Strong Biomarker [3]
Colitis DISAF7DD Strong Biomarker [7]
Craniosynostosis DIS6J405 Strong Altered Expression [8]
Hepatitis DISXXX35 Strong Altered Expression [9]
Hepatocellular carcinoma DIS0J828 Strong Altered Expression [10]
Lung carcinoma DISTR26C Strong Biomarker [11]
Lymphoma DISN6V4S Strong Altered Expression [1]
Nasal polyp DISLP3XE Strong Altered Expression [12]
Neoplasm DISZKGEW Strong Biomarker [10]
Parasitic infection DISX9CEW Strong Altered Expression [2]
Pediatric lymphoma DIS51BK2 Strong Altered Expression [1]
Psoriasis DIS59VMN Strong Altered Expression [13]
Psoriatic arthritis DISLWTG2 Strong Biomarker [14]
Sarcoidosis DISE5B8Z Strong Biomarker [3]
Schizophrenia DISSRV2N Strong Genetic Variation [15]
Melanoma DIS1RRCY moderate Biomarker [16]
Mood disorder DISLVMWO moderate Biomarker [15]
Rheumatoid arthritis DISTSB4J Disputed Biomarker [14]
Eosinophilic esophagitis DISR8WSB Limited Altered Expression [17]
Nervous system inflammation DISB3X5A Limited Altered Expression [18]
------------------------------------------------------------------------------------
⏷ Show the Full List of 29 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Interleukin-9 receptor (IL9R). [19]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Interleukin-9 receptor (IL9R). [20]
------------------------------------------------------------------------------------

References

1 Interleukin-9 promotes cell survival and drug resistance in diffuse large B-cell lymphoma.J Exp Clin Cancer Res. 2016 Jul 1;35(1):106. doi: 10.1186/s13046-016-0374-3.
2 Th9 lymphocytes and functions of interleukin 9 with the focus on IBD pathology.Adv Med Sci. 2018 Sep;63(2):278-284. doi: 10.1016/j.advms.2018.03.002. Epub 2018 Mar 20.
3 IL-9 and its receptor in allergic and nonallergic lung disease: increased expression in asthma.J Allergy Clin Immunol. 2000 Jan;105(1 Pt 1):108-15. doi: 10.1016/s0091-6749(00)90185-4.
4 IL-9 induces VEGF secretion from human mast cells and IL-9/IL-9 receptor genes are overexpressed in atopic dermatitis.PLoS One. 2012;7(3):e33271. doi: 10.1371/journal.pone.0033271. Epub 2012 Mar 8.
5 An association between IL-9 and IL-9 receptor gene polymorphisms and atopic dermatitis in a Korean population.J Dermatol Sci. 2011 Apr;62(1):16-21. doi: 10.1016/j.jdermsci.2011.01.007. Epub 2011 Jan 22.
6 Th9 cytokines curb cervical cancer progression and immune evasion.Hum Immunol. 2019 Dec;80(12):1020-1025. doi: 10.1016/j.humimm.2019.09.009. Epub 2019 Sep 25.
7 TH9 cells that express the transcription factor PU.1 drive T cell-mediated colitis via IL-9 receptor signaling in intestinal epithelial cells.Nat Immunol. 2014 Jul;15(7):676-86. doi: 10.1038/ni.2920. Epub 2014 Jun 8.
8 Expression and regulation of interleukin-9 in chronic rhinosinusitis.Am J Rhinol Allergy. 2015 Jan-Feb;29(1):e18-23. doi: 10.2500/ajra.2015.29.4136.
9 TGF-/Smad signaling pathway positively up-regulates the differentiation of Interleukin-9-producing CD4(+) T cells in human Echinococcus granulosus infection.J Infect. 2018 Apr;76(4):406-416. doi: 10.1016/j.jinf.2018.01.005. Epub 2018 Feb 2.
10 High expression of IL-9R promotes the progression of human hepatocellular carcinoma and indicates a poor clinical outcome.Oncol Rep. 2015 Aug;34(2):795-802. doi: 10.3892/or.2015.4060. Epub 2015 Jun 15.
11 Robust tumor immunity to melanoma mediated by interleukin-9-producing T cells.Nat Med. 2012 Aug;18(8):1248-53. doi: 10.1038/nm.2856. Epub 2012 Jul 8.
12 Involvement of IL-9 in the bronchial phenotype of patients with nasal polyposis.J Allergy Clin Immunol. 2004 Mar;113(3):462-9. doi: 10.1016/j.jaci.2003.12.009.
13 Involvement of IL-9 in Th17-associated inflammation and angiogenesis of psoriasis.PLoS One. 2013;8(1):e51752. doi: 10.1371/journal.pone.0051752. Epub 2013 Jan 15.
14 IL-9 receptor: Regulatory role on FLS and pannus formation.Cytokine. 2018 Nov;111:58-62. doi: 10.1016/j.cyto.2018.08.001. Epub 2018 Aug 14.
15 Pseudoautosomal gene: possible association with bipolar males but not with schizophrenia.Psychiatr Genet. 1999 Sep;9(3):129-34.
16 IL-9 promotes the survival and function of human melanoma-infiltrating CD4(+) CD8(+) double-positive Tcells.Eur J Immunol. 2016 Jul;46(7):1770-82. doi: 10.1002/eji.201546061. Epub 2016 May 6.
17 Interleukin 9 Alters Epithelial Barrier and E-cadherin in Eosinophilic Esophagitis.J Pediatr Gastroenterol Nutr. 2019 Feb;68(2):225-231. doi: 10.1097/MPG.0000000000002144.
18 Neutralization of Interleukin-9 Decreasing Mast Cells Infiltration in Experimental Autoimmune Encephalomyelitis.Chin Med J (Engl). 2017 Apr 20;130(8):964-971. doi: 10.4103/0366-6999.204110.
19 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
20 Genome-wide transcriptional and functional analysis of human T lymphocytes treated with benzo[alpha]pyrene. Int J Mol Sci. 2018 Nov 17;19(11).