Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTIMFI31)

• DOT Name: Oligodendrocyte transcription factor 1 (OLIG1)
• Synonyms: Oligo1; Class B basic helix-loop-helix protein 6; bHLHb6; Class E basic helix-loop-helix protein 21; bHLHe21
• Gene Name: OLIG1
• Related Disease:
  Lung neoplasm
  Multiple sclerosis
  Non-small-cell lung cancer
  Advanced cancer
  Brain neoplasm
  Cerebral infarction
  Glycogen storage disease III
  Major depressive disorder
  Neoplasm
  Nervous system inflammation
  Non-insulin dependent diabetes
  Obsessive compulsive disorder
  Tourette syndrome
  Glioblastoma multiforme
• UniProt ID: OLIG1_HUMAN
• Pfam ID: PF00010
• Sequence:
  MYYAVSQARVNAVPGTMLRPQRPGDLQLGASLYELVGYRQPPSSSSSSTSSTSSTSSSST
  TAPLLPKAAREKPEAPAEPPGPGPGSGAHPGGSARPDAKEEQQQQLRRKINSRERKRMQD
  LNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYILLLGSSLQELRRALGEGAG
  PAAPRLLLAGLPLLAAAPGSVLLAPGAVGPPDALRPAKYLSLALDEPPCGQFALPGGGAG
  GPGLCTCAVCKFPHLVPASLGLAAVQAQFSK
• Function: Promotes formation and maturation of oligodendrocytes, especially within the brain. Cooperates with OLIG2 to establish the pMN domain of the embryonic neural tube.
• Tissue Specificity: Expressed in the brain, in oligodendrocytes. Strongly expressed in oligodendrogliomas, while expression is weak to moderate in astrocytomas. Expression in glioblastomas is highly variable.

Molecular Interaction Atlas (MIA) of This DOT

14 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Lung neoplasm	DISVARNB	Definitive	Altered Expression	[1]
Multiple sclerosis	DISB2WZI	Definitive	Altered Expression	[2]
Non-small-cell lung cancer	DIS5Y6R9	Definitive	Altered Expression	[1]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Brain neoplasm	DISY3EKS	Strong	Altered Expression	[4]
Cerebral infarction	DISR1WNP	Strong	Altered Expression	[5]
Glycogen storage disease III	DISTXQ1P	Strong	Genetic Variation	[6]
Major depressive disorder	DIS4CL3X	Strong	Altered Expression	[7]
Neoplasm	DISZKGEW	Strong	Altered Expression	[4]
Nervous system inflammation	DISB3X5A	Strong	Biomarker	[8]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Altered Expression	[9]
Obsessive compulsive disorder	DIS1ZMM2	Strong	Biomarker	[10]
Tourette syndrome	DISX9D54	Strong	Biomarker	[10]
Glioblastoma multiforme	DISK8246	Limited	Altered Expression	[4]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Oligodendrocyte transcription factor 1 (OLIG1).	[11]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Oligodendrocyte transcription factor 1 (OLIG1).	[16]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Oligodendrocyte transcription factor 1 (OLIG1).	[12]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Oligodendrocyte transcription factor 1 (OLIG1).	[13]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Oligodendrocyte transcription factor 1 (OLIG1).	[14]
Marinol	DM70IK5	Approved	Marinol increases the expression of Oligodendrocyte transcription factor 1 (OLIG1).	[15]

References

• [1] Aberrant DNA methylation of OLIG1, a novel prognostic factor in non-small cell lung cancer.PLoS Med. 2007 Mar 27;4(3):e108. doi: 10.1371/journal.pmed.0040108.
• [2] Effects of green tea epigallocatechin-3-gallate on the proteolipid protein and oligodendrocyte transcription factor 1 messenger RNA gene expression in a mouse model of multiple sclerosis.Folia Neuropathol. 2017;55(3):199-205. doi: 10.5114/fn.2017.70484.
• [3] Requirement of the transcription factor YB-1 for maintaining the stemness of cancer stem cells and reverting differentiated cancer cells into cancer stem cells.Stem Cell Res Ther. 2019 Aug 2;10(1):233. doi: 10.1186/s13287-019-1360-4.
• [4] Analysis of the bHLH transcription factors Olig1 and Olig2 in brain tumors.J Neurooncol. 2004 May;67(3):265-71. doi: 10.1023/b:neon.0000024190.56750.81.
• [5] Effects of the transcription factor Olig1 on the differentiation and remyelination of oligodendrocyte precursor cells after focal cerebral ischemia in rats.Mol Med Rep. 2019 Nov;20(5):4603-4611. doi: 10.3892/mmr.2019.10713. Epub 2019 Sep 26.
• [6] Egyptian glycogen storage disease type III - identification of six novel AGL mutations, including a large 1.5 kb deletion and a missense mutation p.L620P with subtype IIId.Clin Chem Lab Med. 2009;47(10):1233-8. doi: 10.1515/CCLM.2009.281.
• [7] Oligodendrocyte morphometry and expression of myelin - Related mRNA in ventral prefrontal white matter in major depressive disorder.J Psychiatr Res. 2015 Jun;65:53-62. doi: 10.1016/j.jpsychires.2015.04.010. Epub 2015 Apr 20.
• [8] Effect of catalpol on remyelination through experimental autoimmune encephalomyelitis acting to promote Olig1 and Olig2 expressions in mice.BMC Complement Altern Med. 2017 May 2;17(1):240. doi: 10.1186/s12906-017-1642-2.
• [9] Presence of White Matter Lesions Associated with Diabetes-Associated Cognitive Decline in Male Rat Models of Pre-Type 2 Diabetes.Med Sci Monit. 2019 Dec 18;25:9679-9689. doi: 10.12659/MSM.918557.
• [10] A genetic family-based association study of OLIG2 in obsessive-compulsive disorder.Arch Gen Psychiatry. 2007 Feb;64(2):209-14. doi: 10.1001/archpsyc.64.2.209.
• [11] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [12] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [13] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [14] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [15] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [16] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.