Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTINRFC7)

DOT Name	Dermatopontin (DPT)
Synonyms	Tyrosine-rich acidic matrix protein; TRAMP
Gene Name	DPT
Related Disease	Advanced cancer ( ) Autoimmune disease ( ) Bone giant cell tumor ( ) Breast cancer ( ) Breast carcinoma ( ) Glucocorticoid resistance ( ) Hepatocellular carcinoma ( ) Leiomyoma ( ) Measles ( ) Prostate adenocarcinoma ( ) Thyroid gland papillary carcinoma ( ) Uterine fibroids ( ) Carcinoma ( ) Neuroendocrine cancer ( ) Obesity ( ) Bone osteosarcoma ( ) Metastatic malignant neoplasm ( ) Osteosarcoma ( ) Castration-resistant prostate carcinoma ( ) Gastric cancer ( ) Hepatitis B virus infection ( ) Non-insulin dependent diabetes ( ) Pachyonychia congenita 3 ( ) Pneumonia ( ) Prostate neoplasm ( ) Stomach cancer ( ) Varicose veins ( )
UniProt ID	DERM_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF14704
Sequence	MDLSLLWVLLPLVTMAWGQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVR SIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYF ESVLDREWQFYCCRYSKRCPYSCWLTTEYPGHYGEEMDMISYNYDYYIRGATTTFSAVER DRQWKFIMCRMTEYDCEFANV
Function	Seems to mediate adhesion by cell surface integrin binding. May serve as a communication link between the dermal fibroblast cell surface and its extracellular matrix environment. Enhances TGFB1 activity. Inhibits cell proliferation. Accelerates collagen fibril formation, and stabilizes collagen fibrils against low-temperature dissociation.
Tissue Specificity	Expressed in fibroblasts, heart, skeletal muscle, brain and pancreas. Expressed at an intermediate level in lung and kidney, and at a low level in liver and placenta. Expressed at a lower level in fibroblasts from hypertrophic scar lesional skin and in fibroblasts from patients with systemic sclerosis than in normal skin fibroblasts.

Molecular Interaction Atlas (MIA) of This DOT

27 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Advanced cancer	DISAT1Z9	Strong	Biomarker	[1]
Autoimmune disease	DISORMTM	Strong	Biomarker	[2]
Bone giant cell tumor	DIS0RGK9	Strong	Biomarker	[3]
Breast cancer	DIS7DPX1	Strong	Biomarker	[4]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[4]
Glucocorticoid resistance	DIS3HNXT	Strong	Altered Expression	[5]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[6]
Leiomyoma	DISLDDFN	Strong	Altered Expression	[7]
Measles	DISXSUID	Strong	Biomarker	[8]
Prostate adenocarcinoma	DISBZYU8	Strong	Biomarker	[9]
Thyroid gland papillary carcinoma	DIS48YMM	Strong	Biomarker	[10]
Uterine fibroids	DISBZRMJ	Strong	Biomarker	[11]
Carcinoma	DISH9F1N	moderate	Biomarker	[12]
Neuroendocrine cancer	DISVGJET	moderate	Biomarker	[13]
Obesity	DIS47Y1K	moderate	Genetic Variation	[14]
Bone osteosarcoma	DIST1004	Disputed	Biomarker	[15]
Metastatic malignant neoplasm	DIS86UK6	Disputed	Biomarker	[16]
Osteosarcoma	DISLQ7E2	Disputed	Biomarker	[15]
Castration-resistant prostate carcinoma	DISVGAE6	Limited	Genetic Variation	[17]
Gastric cancer	DISXGOUK	Limited	Altered Expression	[18]
Hepatitis B virus infection	DISLQ2XY	Limited	Biomarker	[19]
Non-insulin dependent diabetes	DISK1O5Z	Limited	Biomarker	[20]
Pachyonychia congenita 3	DISZLC6C	Limited	Biomarker	[21]
Pneumonia	DIS8EF3M	Limited	Biomarker	[19]
Prostate neoplasm	DISHDKGQ	Limited	Altered Expression	[22]
Stomach cancer	DISKIJSX	Limited	Altered Expression	[18]
Varicose veins	DISIMBN2	Limited	Biomarker	[23]
------------------------------------------------------------------------------------


⏷ Show the Full List of 27 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Dermatopontin (DPT).	[24]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Dermatopontin (DPT).	[25]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Dermatopontin (DPT).	[27]
Folic acid	DMEMBJC	Approved	Folic acid affects the expression of Dermatopontin (DPT).	[28]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of Dermatopontin (DPT).	[29]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Dermatopontin (DPT).	[24]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Dermatopontin (DPT).	[30]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Dermatopontin (DPT).	[32]
------------------------------------------------------------------------------------


⏷ Show the Full List of 8 Drug(s)

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Dermatopontin (DPT).	[26]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Dermatopontin (DPT).	[31]
------------------------------------------------------------------------------------

References

1	A TRAMP-derived orthotopic prostate syngeneic (TOPS) cancer model for investigating anti-tumor treatments.Prostate. 2018 May;78(6):457-468. doi: 10.1002/pros.23490. Epub 2018 Feb 16.
2	Population-wide infant screening for HLA-based type 1 diabetes risk via dried blood spots from the public health infrastructure.Ann N Y Acad Sci. 2003 Nov;1005:400-3. doi: 10.1196/annals.1288.067.
3	Gene expression profiling of giant cell tumor of bone reveals downregulation of extracellular matrix components decorin and lumican associated with lung metastasis.Virchows Arch. 2014 Dec;465(6):703-13. doi: 10.1007/s00428-014-1666-7. Epub 2014 Oct 11.
4	Network-Based Methods to Identify Highly Discriminating Subsets of Biomarkers.IEEE/ACM Trans Comput Biol Bioinform. 2014 Nov-Dec;11(6):1029-37. doi: 10.1109/TCBB.2014.2325014.
5	Epigenetically altered wound healing in keloid fibroblasts.J Invest Dermatol. 2010 Oct;130(10):2489-96. doi: 10.1038/jid.2010.162. Epub 2010 Jun 17.
6	DNA methylation-mediated silencing of matricellular protein dermatopontin promotes hepatocellular carcinoma metastasis by 31 integrin-Rho GTPase signaling.Oncotarget. 2014 Aug 30;5(16):6701-15. doi: 10.18632/oncotarget.2239.
7	Development and validation of a three-dimensional in vitro model for uterine leiomyoma and patient-matched myometrium.Fertil Steril. 2012 Jun;97(6):1287-93. doi: 10.1016/j.fertnstert.2012.02.037. Epub 2012 Mar 15.
8	Exploring the spatial heterogeneity in different doses of vaccination coverage in India.PLoS One. 2018 Nov 28;13(11):e0207209. doi: 10.1371/journal.pone.0207209. eCollection 2018.
9	Systemic alkalinisation delays prostate cancer cell progression in TRAMP mice.J Enzyme Inhib Med Chem. 2017 Dec;32(1):363-368. doi: 10.1080/14756366.2016.1252760.
10	Dermatopontin inhibits papillary thyroid cancer cell proliferation through MYC repression.Mol Cell Endocrinol. 2019 Jan 15;480:122-132. doi: 10.1016/j.mce.2018.10.021. Epub 2018 Nov 2.
11	Integrated analysis reveals candidate mRNA and their potential roles in uterine leiomyomas.J Obstet Gynaecol Res. 2017 Jan;43(1):149-156. doi: 10.1111/jog.13172. Epub 2016 Dec 17.
12	Inhibition of tumor growth and metastasis by EMMPRIN multiple antigenic peptide (MAP) vaccination is mediated by immune modulation.Oncoimmunology. 2016 Nov 29;6(1):e1261778. doi: 10.1080/2162402X.2016.1261778. eCollection 2017.
13	The landscape of somatic chromosomal copy number aberrations in GEM models of prostate carcinoma.Mol Cancer Res. 2015 Feb;13(2):339-47. doi: 10.1158/1541-7786.MCR-14-0262. Epub 2014 Oct 8.
14	Obesity-associated, but not obesity-independent, tumors respond to insulin by increasing mitochondrial glucose oxidation.PLoS One. 2019 Jun 12;14(6):e0218126. doi: 10.1371/journal.pone.0218126. eCollection 2019.
15	Effects of Dermatopontin gene silencing on apoptosis and proliferation of osteosarcoma MG?3 cells.Mol Med Rep. 2018 Jan;17(1):422-427. doi: 10.3892/mmr.2017.7866. Epub 2017 Oct 25.
16	Leupaxin acts as a mediator in prostate carcinoma progression through deregulation of p120catenin expression.Oncogene. 2009 Nov 12;28(45):3971-82. doi: 10.1038/onc.2009.254. Epub 2009 Aug 24.
17	Overexpression of SOCS3 mediated by adenovirus vector in mouse and human castration-resistant prostate cancer cells increases the sensitivity to NK cells in vitro and in vivo.Cancer Gene Ther. 2019 Nov;26(11-12):388-399. doi: 10.1038/s41417-018-0075-5. Epub 2019 Jan 4.
18	Transcriptome profiling of cancer tissues in Chinese patients with gastric cancer by high-throughput sequencing.Oncol Lett. 2018 Feb;15(2):2057-2064. doi: 10.3892/ol.2017.7548. Epub 2017 Dec 8.
19	Pneumonia prevention: Cost-effectiveness analyses of two vaccines among refugee children aged under two years, Haemophilus influenzae type b-containing and pneumococcal conjugate vaccines, during a humanitarian emergency, Yida camp, South Sudan.Vaccine. 2017 Jan 11;35(3):435-442. doi: 10.1016/j.vaccine.2016.11.070. Epub 2016 Dec 15.
20	Glipizide suppresses prostate cancer progression in the TRAMP model by inhibiting angiogenesis.Sci Rep. 2016 Jun 13;6:27819. doi: 10.1038/srep27819.
21	Extracellular matrix dermatopontin modulates prostate cell growth in vivo.J Endocrinol. 2006 Aug;190(2):351-61. doi: 10.1677/joe.1.06619.
22	The secreted matrix protein mindin increases prostate tumor progression and tumor-bone crosstalk via ERK 1/2 regulation.Carcinogenesis. 2019 Jul 20;40(7):828-839. doi: 10.1093/carcin/bgz105.
23	Identification of differentially expressed genes in human varicose veins: involvement of matrix gla protein in extracellular matrix remodeling.J Vasc Res. 2007;44(6):444-59. doi: 10.1159/000106189. Epub 2007 Jul 20.
24	Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
25	Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
26	Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
27	Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
28	Folate deficiency in normal human fibroblasts leads to altered expression of genes primarily linked to cell signaling, the cytoskeleton and extracellular matrix. J Nutr Biochem. 2007 Aug;18(8):541-52. doi: 10.1016/j.jnutbio.2006.11.002. Epub 2007 Feb 22.
29	Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
30	Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
31	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
32	Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.