Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTIRKKEQ)

DOT Name Urokinase plasminogen activator surface receptor (PLAUR)
Synonyms U-PAR; uPAR; Monocyte activation antigen Mo3; CD antigen CD87
Gene Name PLAUR
UniProt ID
UPAR_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1YWH; 2FD6; 2I9B; 3BT1; 3BT2; 3U73; 3U74; 4K24; 4QTI; 7E17; 7V63
Pfam ID
PF00021
Sequence
MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEEL
ELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISC
GSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNG
FHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGP
MNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDV
QYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT
Function
Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA. It is subject to negative-feedback regulation by U-PA which cleaves it into an inactive form.
Tissue Specificity Expressed in neurons of the rolandic area of the brain (at protein level). Expressed in the brain.
KEGG Pathway
Complement and coagulation cascades (hsa04610 )
Proteoglycans in cancer (hsa05205 )
Reactome Pathway
Neutrophil degranulation (R-HSA-6798695 )
Dissolution of Fibrin Clot (R-HSA-75205 )
Attachment of GPI anchor to uPAR (R-HSA-162791 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 1 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Urokinase DM0GOUD Approved Urokinase plasminogen activator surface receptor (PLAUR) increases the Chromosomal abnormalities and abnormal gene carriers ADR of Urokinase. [47]
------------------------------------------------------------------------------------
51 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate affects the expression of Urokinase plasminogen activator surface receptor (PLAUR). [1]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [2]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [3]
Acetaminophen DMUIE76 Approved Acetaminophen affects the expression of Urokinase plasminogen activator surface receptor (PLAUR). [4]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [5]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [6]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [7]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [8]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [9]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [10]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide increases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [11]
Calcitriol DM8ZVJ7 Approved Calcitriol decreases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [12]
Testosterone DM7HUNW Approved Testosterone decreases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [12]
Triclosan DMZUR4N Approved Triclosan increases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [13]
Fulvestrant DM0YZC6 Approved Fulvestrant decreases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [14]
Dexamethasone DMMWZET Approved Dexamethasone decreases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [15]
Folic acid DMEMBJC Approved Folic acid affects the expression of Urokinase plasminogen activator surface receptor (PLAUR). [16]
Diethylstilbestrol DMN3UXQ Approved Diethylstilbestrol increases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [14]
Aspirin DM672AH Approved Aspirin increases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [17]
Nicotine DMWX5CO Approved Nicotine increases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [18]
Piroxicam DMTK234 Approved Piroxicam decreases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [19]
Sodium lauryl sulfate DMLJ634 Approved Sodium lauryl sulfate increases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [20]
Malathion DMXZ84M Approved Malathion increases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [21]
Capsaicin DMGMF6V Approved Capsaicin increases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [22]
Acocantherin DM7JT24 Approved Acocantherin decreases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [23]
Phenytoin DMNOKBV Approved Phenytoin decreases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [24]
Bexarotene DMOBIKY Approved Bexarotene decreases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [25]
Sevoflurane DMC9O43 Approved Sevoflurane increases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [26]
Mestranol DMG3F94 Approved Mestranol increases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [14]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [27]
Resveratrol DM3RWXL Phase 3 Resveratrol decreases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [28]
Curcumin DMQPH29 Phase 3 Curcumin increases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [29]
Napabucasin DMDZ6Q3 Phase 3 Napabucasin decreases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [30]
Genistein DM0JETC Phase 2/3 Genistein increases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [14]
PD-0325901 DM27D4J Phase 2 PD-0325901 decreases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [31]
URSOLIC ACID DM4SOAW Phase 2 URSOLIC ACID decreases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [32]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [33]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [34]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [35]
HEXESTROL DM9AGWQ Withdrawn from market HEXESTROL increases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [14]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [36]
Milchsaure DM462BT Investigative Milchsaure increases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [37]
Acetaldehyde DMJFKG4 Investigative Acetaldehyde increases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [38]
3R14S-OCHRATOXIN A DM2KEW6 Investigative 3R14S-OCHRATOXIN A increases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [39]
Phencyclidine DMQBEYX Investigative Phencyclidine increases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [40]
Okadaic acid DM47CO1 Investigative Okadaic acid increases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [41]
Cycloheximide DMGDA3C Investigative Cycloheximide increases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [42]
DM9CEI5 increases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [43]
biochanin A DM0HPWY Investigative biochanin A decreases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [44]
Choline DM5D9YK Investigative Choline affects the expression of Urokinase plasminogen activator surface receptor (PLAUR). [45]
Beta-D-Glucose DM5IHYP Investigative Beta-D-Glucose increases the expression of Urokinase plasminogen activator surface receptor (PLAUR). [46]
------------------------------------------------------------------------------------
⏷ Show the Full List of 51 Drug(s)

References

1 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
2 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
3 [Clinical study on the fibrinolytic activity in patients with acute promyelocytic leukemia]. Zhonghua Xue Ye Xue Za Zhi. 2009 Mar;30(3):145-9.
4 Identification of potential biomarkers of hepatitis B-induced acute liver failure using hepatic cells derived from human skin precursors. Toxicol In Vitro. 2015 Sep;29(6):1231-9. doi: 10.1016/j.tiv.2014.10.012. Epub 2014 Oct 24.
5 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
6 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
7 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
8 Long-term estrogen exposure promotes carcinogen bioactivation, induces persistent changes in gene expression, and enhances the tumorigenicity of MCF-7 human breast cancer cells. Toxicol Appl Pharmacol. 2009 Nov 1;240(3):355-66.
9 Quercetin inhibits invasion, migration and signalling molecules involved in cell survival and proliferation of prostate cancer cell line (PC-3). Cell Biochem Funct. 2011 Mar;29(2):87-95. doi: 10.1002/cbf.1725. Epub 2011 Feb 9.
10 Arsenic suppresses gene expression in promyelocytic leukemia cells partly through Sp1 oxidation. Blood. 2005 Jul 1;106(1):304-10.
11 Nicotine stimulates urokinase-type plasminogen activator receptor expression and cell invasiveness through mitogen-activated protein kinase and reactive oxygen species signaling in ECV304 endothelial cells. Toxicol Appl Pharmacol. 2012 Mar 1;259(2):248-56. doi: 10.1016/j.taap.2012.01.002. Epub 2012 Jan 9.
12 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
13 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
14 Moving toward integrating gene expression profiling into high-throughput testing: a gene expression biomarker accurately predicts estrogen receptor alpha modulation in a microarray compendium. Toxicol Sci. 2016 May;151(1):88-103.
15 Glucocorticoid regulation of human eosinophil gene expression. J Steroid Biochem Mol Biol. 2003 Mar;84(4):441-52. doi: 10.1016/s0960-0760(03)00065-7.
16 Effects of folate deficiency on gene expression in the apoptosis and cancer pathways in colon cancer cells. Carcinogenesis. 2006 May;27(5):916-24. doi: 10.1093/carcin/bgi312. Epub 2005 Dec 16.
17 Aspirin upregulates expression of urokinase type plasminogen activator receptor (uPAR) gene in human colon cancer cells through AP1. Biochem Biophys Res Commun. 2006 Sep 22;348(2):618-27. doi: 10.1016/j.bbrc.2006.07.098. Epub 2006 Jul 28.
18 Activation of 5-lipoxygenase is required for nicotine mediated epithelial-mesenchymal transition and tumor cell growth. Cancer Lett. 2010 Jun 28;292(2):237-45.
19 Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
20 CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
21 Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
22 Capsaicin promotes a more aggressive gene expression phenotype and invasiveness in null-TRPV1 urothelial cancer cells. Carcinogenesis. 2011 May;32(5):686-94. doi: 10.1093/carcin/bgr025. Epub 2011 Feb 10.
23 Ouabain impairs cell migration, and invasion and alters gene expression of human osteosarcoma U-2 OS cells. Environ Toxicol. 2017 Nov;32(11):2400-2413. doi: 10.1002/tox.22453. Epub 2017 Aug 10.
24 Role of phenytoin in wound healing: microarray analysis of early transcriptional responses in human dermal fibroblasts. Biochem Biophys Res Commun. 2004 Feb 13;314(3):661-6. doi: 10.1016/j.bbrc.2003.12.146.
25 Identification of biomarkers modulated by the rexinoid LGD1069 (bexarotene) in human breast cells using oligonucleotide arrays. Cancer Res. 2006 Dec 15;66(24):12009-18.
26 The differential cancer growth associated with anaesthetics in a cancer xenograft model of mice: mechanisms and implications of postoperative cancer recurrence. Cell Biol Toxicol. 2023 Aug;39(4):1561-1575. doi: 10.1007/s10565-022-09747-9. Epub 2022 Aug 12.
27 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
28 Resveratrol reduces TNF--induced U373MG human glioma cell invasion through regulating NF-B activation and uPA/uPAR expression. Anticancer Res. 2011 Dec;31(12):4223-30.
29 Gene expression profiling identifies activating transcription factor 3 as a novel contributor to the proapoptotic effect of curcumin. Mol Cancer Ther. 2005 Feb;4(2):233-41.
30 Suppression of cancer relapse and metastasis by inhibiting cancer stemness. Proc Natl Acad Sci U S A. 2015 Feb 10;112(6):1839-44. doi: 10.1073/pnas.1424171112. Epub 2015 Jan 20.
31 PRC2 loss amplifies Ras-driven transcription and confers sensitivity to BRD4-based therapies. Nature. 2014 Oct 9;514(7521):247-51.
32 Ursolic and oleanolic acids in combination therapy inhibit migration of colon cancer cells through down-regulation of the uPA/uPAR-dependent MMPs pathway. Chem Biol Interact. 2022 Dec 1;368:110202. doi: 10.1016/j.cbi.2022.110202. Epub 2022 Oct 1.
33 Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
34 The BET bromodomain inhibitor JQ1 suppresses growth of pancreatic ductal adenocarcinoma in patient-derived xenograft models. Oncogene. 2016 Feb 18;35(7):833-45.
35 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
36 Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
37 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
38 Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
39 Transcriptomic alterations induced by Ochratoxin A in rat and human renal proximal tubular in vitro models and comparison to a rat in vivo model. Arch Toxicol. 2012 Apr;86(4):571-89.
40 Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.
41 Okadaic acid activates Wnt/-catenin-signaling in human HepaRG cells. Arch Toxicol. 2019 Jul;93(7):1927-1939. doi: 10.1007/s00204-019-02489-4. Epub 2019 May 21.
42 Interferon-alpha (Intron A) upregulates urokinase-type plasminogen activator receptor gene expression. Cancer Immunol Immunother. 2002 Jul;51(5):248-54. doi: 10.1007/s00262-002-0275-5. Epub 2002 Apr 9.
43 Lithocholic acid upregulates uPAR and cell invasiveness via MAPK and AP-1 signaling in colon cancer cells. Cancer Lett. 2010 Apr 1;290(1):123-8. doi: 10.1016/j.canlet.2009.08.030. Epub 2009 Sep 25.
44 Inhibition of matrix degrading enzymes and invasion in human glioblastoma (U87MG) cells by isoflavones. J Neurooncol. 2006 Sep;79(2):135-42. doi: 10.1007/s11060-006-9126-0. Epub 2006 Apr 6.
45 Lymphocyte gene expression in subjects fed a low-choline diet differs between those who develop organ dysfunction and those who do not. Am J Clin Nutr. 2007 Jul;86(1):230-9. doi: 10.1093/ajcn/86.1.230.
46 Regulation and possible function of beta-catenin in human monocytes. J Immunol. 2001 Dec 15;167(12):6786-93. doi: 10.4049/jimmunol.167.12.6786.
47 ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.