General Information of Drug Off-Target (DOT) (ID: OTIUB1B3)

DOT Name Lysosomal-trafficking regulator (LYST)
Synonyms Beige homolog
Gene Name LYST
Related Disease
Chediak-Higashi syndrome ( )
Chronic kidney disease ( )
Hermansky-Pudlak syndrome ( )
Advanced cancer ( )
Albinism ( )
Arteriosclerosis ( )
Atherosclerosis ( )
Atrial fibrillation ( )
Cardiac failure ( )
Congestive heart failure ( )
Hemophagocytic syndrome ( )
Hermansky-Pudlak syndrome 1 ( )
Nasal polyp ( )
Neoplasm ( )
Oculocutaneous albinism ( )
Onychomycosis ( )
Parkinsonian disorder ( )
Piebaldism ( )
Platelet storage pool deficiency ( )
Schizophrenia ( )
Trichohepatoenteric syndrome ( )
X-linked lymphoproliferative syndrome ( )
Cohen syndrome ( )
Immunodeficiency ( )
Attenuated Chdiak-Higashi syndrome ( )
Chordoma ( )
Epstein barr virus infection ( )
Plasma cell myeloma ( )
Systemic lupus erythematosus ( )
UniProt ID
LYST_HUMAN
Pfam ID
PF02138 ; PF14844 ; PF00400
Sequence
MSTDSNSLAREFLTDVNRLCNAVVQRVEAREEEEEETHMATLGQYLVHGRGFLLLTKLNS
IIDQALTCREELLTLLLSLLPLVWKIPVQEEKATDFNLPLSADIILTKEKNSSSQRSTQE
KLHLEGSALSSQVSAKVNVFRKSRRQRKITHRYSVRDARKTQLSTSDSEANSDEKGIAMN
KHRRPHLLHHFLTSFPKQDHPKAKLDRLATKEQTPPDAMALENSREIIPRQGSNTDILSE
PAALSVISNMNNSPFDLCHVLLSLLEKVCKFDVTLNHNSPLAASVVPTLTEFLAGFGDCC
SLSDNLESRVVSAGWTEEPVALIQRMLFRTVLHLLSVDVSTAEMMPENLRKNLTELLRAA
LKIRICLEKQPDPFAPRQKKTLQEVQEDFVFSKYRHRALLLPELLEGVLQILICCLQSAA
SNPFYFSQAMDLVQEFIQHHGFNLFETAVLQMEWLVLRDGVPPEASEHLKALINSVMKIM
STVKKVKSEQLHHSMCTRKRHRRCEYSHFMHHHRDLSGLLVSAFKNQVSKNPFEETADGD
VYYPERCCCIAVCAHQCLRLLQQASLSSTCVQILSGVHNIGICCCMDPKSVIIPLLHAFK
LPALKNFQQHILNILNKLILDQLGGAEISPKIKKAACNICTVDSDQLAQLEETLQGNLCD
AELSSSLSSPSYRFQGILPSSGSEDLLWKWDALKAYQNFVFEEDRLHSIQIANHICNLIQ
KGNIVVQWKLYNYIFNPVLQRGVELAHHCQHLSVTSAQSHVCSHHNQCLPQDVLQIYVKT
LPILLKSRVIRDLFLSCNGVSQIIELNCLNGIRSHSLKAFETLIISLGEQQKDASVPDID
GIDIEQKELSSVHVGTSFHHQQAYSDSPQSLSKFYAGLKEAYPKRRKTVNQDVHINTINL
FLCVAFLCVSKEAESDRESANDSEDTSGYDSTASEPLSHMLPCISLESLVLPSPEHMHQA
ADIWSMCRWIYMLSSVFQKQFYRLGGFRVCHKLIFMIIQKLFRSHKEEQGKKEGDTSVNE
NQDLNRISQPKRTMKEDLLSLAIKSDPIPSELGSLKKSADSLGKLELQHISSINVEEVSA
TEAAPEEAKLFTSQESETSLQSIRLLEALLAICLHGARTSQQKMELELPNQNLSVESILF
EMRDHLSQSKVIETQLAKPLFDALLRVALGNYSADFEHNDAMTEKSHQSAEELSSQPGDF
SEEAEDSQCCSFKLLVEEEGYEADSESNPEDGETQDDGVDLKSETEGFSASSSPNDLLEN
LTQGEIIYPEICMLELNLLSASKAKLDVLAHVFESFLKIIRQKEKNVFLLMQQGTVKNLL
GGFLSILTQDDSDFQACQRVLVDLLVSLMSSRTCSEELTLLLRIFLEKSPCTKILLLGIL
KIIESDTTMSPSQYLTFPLLHAPNLSNGVSSQKYPGILNSKAMGLLRRARVSRSKKEADR
ESFPHRLLSSWHIAPVHLPLLGQNCWPHLSEGFSVSLWFNVECIHEAESTTEKGKKIKKR
NKSLILPDSSFDGTESDRPEGAEYINPGERLIEEGCIHIISLGSKALMIQVWADPHNATL
IFRVCMDSNDDMKAVLLAQVESQENIFLPSKWQHLVLTYLQQPQGKRRIHGKISIWVSGQ
RKPDVTLDFMLPRKTSLSSDSNKTFCMIGHCLSSQEEFLQLAGKWDLGNLLLFNGAKVGS
QEAFYLYACGPNHTSVMPCKYGKPVNDYSKYINKEILRCEQIRELFMTKKDVDIGLLIES
LSVVYTTYCPAQYTIYEPVIRLKGQMKTQLSQRPFSSKEVQSILLEPHHLKNLQPTEYKT
IQGILHEIGGTGIFVFLFARVVELSSCEETQALALRVILSLIKYNQQRVHELENCNGLSM
IHQVLIKQKCIVGFYILKTLLEGCCGEDIIYMNENGEFKLDVDSNAIIQDVKLLEELLLD
WKIWSKAEQGVWETLLAALEVLIRADHHQQMFNIKQLLKAQVVHHFLLTCQVLQEYKEGQ
LTPMPREVCRSFVKIIAEVLGSPPDLELLTIIFNFLLAVHPPTNTYVCHNPTNFYFSLHI
DGKIFQEKVRSIMYLRHSSSGGRSLMSPGFMVISPSGFTASPYEGENSSNIIPQQMAAHM
LRSRSLPAFPTSSLLTQSQKLTGSLGCSIDRLQNIADTYVATQSKKQNSLGSSDTLKKGK
EDAFISSCESAKTVCEMEAVLSAQVSVSDVPKGVLGFPVVKADHKQLGAEPRSEDDSPGD
ESCPRRPDYLKGLASFQRSHSTIASLGLAFPSQNGSAAVGRWPSLVDRNTDDWENFAYSL
GYEPNYNRTASAHSVTEDCLVPICCGLYELLSGVLLILPDVLLEDVMDKLIQADTLLVLV
NHPSPAIQQGVIKLLDAYFARASKEQKDKFLKNRGFSLLANQLYLHRGTQELLECFIEMF
FGRHIGLDEEFDLEDVRNMGLFQKWSVIPILGLIETSLYDNILLHNALLLLLQILNSCSK
VADMLLDNGLLYVLCNTVAALNGLEKNIPMSEYKLLACDIQQLFIAVTIHACSSSGSQYF
RVIEDLIVMLGYLQNSKNKRTQNMAVALQLRVLQAAMEFIRTTANHDSENLTDSLQSPSA
PHHAVVQKRKSIAGPRKFPLAQTESLLMKMRSVANDELHVMMQRRMSQENPSQATETELA
QRLQRLTVLAVNRIIYQEFNSDIIDILRTPENVTQSKTSVFQTEISEENIHHEQSSVFNP
FQKEIFTYLVEGFKVSIGSSKASGSKQQWTKILWSCKETFRMQLGRLLVHILSPAHAAQE
RKQIFEIVHEPNHQEILRDCLSPSLQHGAKLVLYLSELIHNHQGELTEEELGTAELLMNA
LKLCGHKCIPPSASTKADLIKMIKEEQKKYETEEGVNKAAWQKTVNNNQQSLFQRLDSKS
KDISKIAADITQAVSLSQGNERKKVIQHIRGMYKVDLSASRHWQELIQQLTHDRAVWYDP
IYYPTSWQLDPTEGPNRERRRLQRCYLTIPNKYLLRDRQKSEDVVKPPLSYLFEDKTHSS
FSSTVKDKAASESIRVNRRCISVAPSRETAGELLLGKCGMYFVEDNASDTVESSSLQGEL
EPASFSWTYEEIKEVHKRWWQLRDNAVEIFLTNGRTLLLAFDNTKVRDDVYHNILTNNLP
NLLEYGNITALTNLWYTGQITNFEYLTHLNKHAGRSFNDLMQYPVFPFILADYVSETLDL
NDLLIYRNLSKPIAVQYKEKEDRYVDTYKYLEEEYRKGAREDDPMPPVQPYHYGSHYSNS
GTVLHFLVRMPPFTKMFLAYQDQSFDIPDRTFHSTNTTWRLSSFESMTDVKELIPEFFYL
PEFLVNREGFDFGVRQNGERVNHVNLPPWARNDPRLFILIHRQALESDYVSQNICQWIDL
VFGYKQKGKASVQAINVFHPATYFGMDVSAVEDPVQRRALETMIKTYGQTPRQLFHMAHV
SRPGAKLNIEGELPAAVGLLVQFAFRETREQVKEITYPSPLSWIKGLKWGEYVGSPSAPV
PVVCFSQPHGERFGSLQALPTRAICGLSRNFCLLMTYSKEQGVRSMNSTDIQWSAILSWG
YADNILRLKSKQSEPPVNFIQSSQQYQVTSCAWVPDSCQLFTGSKCGVITAYTNRFTSST
PSEIEMETQIHLYGHTEEITSLFVCKPYSILISVSRDGTCIIWDLNRLCYVQSLAGHKSP
VTAVSASETSGDIATVCDSAGGGSDLRLWTVNGDLVGHVHCREIICSVAFSNQPEGVSIN
VIAGGLENGIVRLWSTWDLKPVREITFPKSNKPIISLTFSCDGHHLYTANSDGTVIAWCR
KDQQRLKQPMFYSFLSSYAAG
Function
Adapter protein that regulates and/or fission of intracellular vesicles such as lysosomes. Might regulate trafficking of effectors involved in exocytosis. In cytotoxic T-cells and natural killer (NK) cells, has role in the regulation of size, number and exocytosis of lytic granules. In macrophages and dendritic cells, regulates phagosome maturation by controlling the conversion of early phagosomal compartments into late phagosomes. In macrophages and dendritic cells, specifically involved in TLR3- and TLR4-induced production of pro-inflammatory cytokines by regulating the endosomal TLR3- TICAM1/TRIF and TLR4- TICAM1/TRIF signaling pathways.
Tissue Specificity Abundantly expressed in adult and fetal thymus, peripheral blood leukocytes, bone marrow and several regions of the adult brain.

Molecular Interaction Atlas (MIA) of This DOT

29 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Chediak-Higashi syndrome DISPJLLO Definitive Autosomal recessive [1]
Chronic kidney disease DISW82R7 Definitive Biomarker [2]
Hermansky-Pudlak syndrome DISCY0HQ Definitive Genetic Variation [3]
Advanced cancer DISAT1Z9 Strong Genetic Variation [4]
Albinism DIS5D82I Strong Biomarker [5]
Arteriosclerosis DISK5QGC Strong Biomarker [6]
Atherosclerosis DISMN9J3 Strong Biomarker [6]
Atrial fibrillation DIS15W6U Strong Genetic Variation [7]
Cardiac failure DISDC067 Strong Genetic Variation [7]
Congestive heart failure DIS32MEA Strong Genetic Variation [7]
Hemophagocytic syndrome DIS3TMN4 Strong Genetic Variation [8]
Hermansky-Pudlak syndrome 1 DIS966LQ Strong Genetic Variation [9]
Nasal polyp DISLP3XE Strong Biomarker [10]
Neoplasm DISZKGEW Strong Biomarker [11]
Oculocutaneous albinism DISJS7CU Strong Genetic Variation [12]
Onychomycosis DISE4C4D Strong Biomarker [13]
Parkinsonian disorder DISHGY45 Strong Biomarker [5]
Piebaldism DISDLDF2 Strong Biomarker [14]
Platelet storage pool deficiency DISHODOH Strong Biomarker [15]
Schizophrenia DISSRV2N Strong Biomarker [16]
Trichohepatoenteric syndrome DISL3ODF Strong Biomarker [17]
X-linked lymphoproliferative syndrome DISA7MJ4 Strong Biomarker [18]
Cohen syndrome DISOOFEZ moderate Biomarker [19]
Immunodeficiency DIS093I0 moderate Biomarker [20]
Attenuated Chdiak-Higashi syndrome DISGRPVO Supportive Autosomal recessive [8]
Chordoma DISCHJE7 Disputed Genetic Variation [4]
Epstein barr virus infection DISOO0WT Limited Genetic Variation [21]
Plasma cell myeloma DIS0DFZ0 Limited Biomarker [22]
Systemic lupus erythematosus DISI1SZ7 Limited Genetic Variation [23]
------------------------------------------------------------------------------------
⏷ Show the Full List of 29 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Lysosomal-trafficking regulator (LYST). [24]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Lysosomal-trafficking regulator (LYST). [37]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the methylation of Lysosomal-trafficking regulator (LYST). [39]
------------------------------------------------------------------------------------
14 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin increases the expression of Lysosomal-trafficking regulator (LYST). [25]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Lysosomal-trafficking regulator (LYST). [26]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Lysosomal-trafficking regulator (LYST). [27]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Lysosomal-trafficking regulator (LYST). [28]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Lysosomal-trafficking regulator (LYST). [29]
Testosterone DM7HUNW Approved Testosterone decreases the expression of Lysosomal-trafficking regulator (LYST). [30]
Phenobarbital DMXZOCG Approved Phenobarbital affects the expression of Lysosomal-trafficking regulator (LYST). [31]
Diethylstilbestrol DMN3UXQ Approved Diethylstilbestrol decreases the expression of Lysosomal-trafficking regulator (LYST). [32]
Amphotericin B DMTAJQE Approved Amphotericin B increases the expression of Lysosomal-trafficking regulator (LYST). [33]
Melphalan DMOLNHF Approved Melphalan decreases the expression of Lysosomal-trafficking regulator (LYST). [34]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Lysosomal-trafficking regulator (LYST). [35]
Seocalcitol DMKL9QO Phase 3 Seocalcitol increases the expression of Lysosomal-trafficking regulator (LYST). [36]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 increases the expression of Lysosomal-trafficking regulator (LYST). [38]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Lysosomal-trafficking regulator (LYST). [40]
------------------------------------------------------------------------------------
⏷ Show the Full List of 14 Drug(s)

References

1 Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
2 Multiple loci associated with indices of renal function and chronic kidney disease.Nat Genet. 2009 Jun;41(6):712-7. doi: 10.1038/ng.377. Epub 2009 May 10.
3 Molecular basis of albinism: mutations and polymorphisms of pigmentation genes associated with albinism. Hum Mutat. 1999;13(2):99-115. doi: 10.1002/(SICI)1098-1004(1999)13:2<99::AID-HUMU2>3.0.CO;2-C.
4 The driver landscape of sporadic chordoma.Nat Commun. 2017 Oct 12;8(1):890. doi: 10.1038/s41467-017-01026-0.
5 [Clinical aspects of hereditary spastic paraplegias].Rinsho Shinkeigaku. 2014;54(12):1012-5. doi: 10.5692/clinicalneurol.54.1012.
6 Relationship Between Physical Activity, Body Mass Index, and Risk of Heart Failure.J Am Coll Cardiol. 2017 Mar 7;69(9):1129-1142. doi: 10.1016/j.jacc.2016.11.081.
7 Ectopy on a Single 12-Lead ECG, Incident Cardiac Myopathy, and Death in the Community.J Am Heart Assoc. 2017 Aug 3;6(8):e006028. doi: 10.1161/JAHA.117.006028.
8 Atypical Chdiak-Higashi syndrome with attenuated phenotype: three adult siblings homozygous for a novel LYST deletion and with neurodegenerative disease. Orphanet J Rare Dis. 2013 Mar 22;8:46. doi: 10.1186/1750-1172-8-46.
9 Genetics of pigmentary disorders.Am J Med Genet C Semin Med Genet. 2004 Nov 15;131C(1):75-81. doi: 10.1002/ajmg.c.30036.
10 GM-CSF, IL-5 and RANTES immunoreactivity and mRNA expression in chronic hyperplastic sinusitis with nasal polyposis (NP).Clin Exp Allergy. 1998 Sep;28(9):1145-52. doi: 10.1046/j.1365-2222.1998.00380.x.
11 Biomimetic nanoassemblies of 1-O-octodecyl-2-conjugated linoleoyl-sn-glycero-3-phosphatidyl gemcitabine with phospholipase A(2)-triggered degradation for the treatment of cancer.Colloids Surf B Biointerfaces. 2017 Apr 1;152:467-474. doi: 10.1016/j.colsurfb.2017.02.001. Epub 2017 Feb 3.
12 Prenatal genotyping of four common oculocutaneous albinism genes in 51 Chinese families.J Genet Genomics. 2015 Jun 20;42(6):279-86. doi: 10.1016/j.jgg.2015.05.001. Epub 2015 May 29.
13 Evaluation of Chitine synthase (CHS1) polymerase chain reaction assay in diagnosis of dermatophyte onychomycosis.J Mycol Med. 2012 Sep;22(3):249-55. doi: 10.1016/j.mycmed.2012.07.050. Epub 2012 Aug 16.
14 Inflammatory demyelinating neuropathy heralding accelerated chediak-higashi syndrome.Muscle Nerve. 2017 May;55(5):756-760. doi: 10.1002/mus.25414. Epub 2017 Feb 3.
15 Lyst mutation in mice recapitulates iris defects of human exfoliation syndrome.Invest Ophthalmol Vis Sci. 2009 Mar;50(3):1205-14. doi: 10.1167/iovs.08-2791. Epub 2008 Nov 21.
16 Mental imagery vividness as a trait marker across the schizophrenia spectrum.Psychiatry Res. 2009 May 15;167(1-2):1-11. doi: 10.1016/j.psychres.2007.12.008. Epub 2009 Apr 3.
17 Chediak-Higashi syndrome.Curr Opin Hematol. 2008 Jan;15(1):22-9. doi: 10.1097/MOH.0b013e3282f2bcce.
18 Familial and acquired hemophagocytic lymphohistiocytosis.Eur J Pediatr. 2007 Feb;166(2):95-109. doi: 10.1007/s00431-006-0258-1. Epub 2006 Dec 7.
19 Cohen syndrome gene assigned to the long arm of chromosome 8 by linkage analysis.Nat Genet. 1994 Jun;7(2):201-4. doi: 10.1038/ng0694-201.
20 A case of Chediak-Higashi syndrome presented with accelerated phase could be treated effectively by unrelated cord blood transplantation.Pediatr Transplant. 2017 Nov;21(7). doi: 10.1111/petr.13014. Epub 2017 Aug 1.
21 Novel mutations of STXBP2 and LYST associated with adult haemophagocytic lymphohistiocytosis with Epstein-Barr virus infection: a case report.BMC Med Genet. 2019 Feb 19;20(1):34. doi: 10.1186/s12881-019-0765-3.
22 Small interfering RNA-mediated silencing of nicotinamide phosphoribosyltransferase (NAMPT) and lysosomal trafficking regulator (LYST) induce growth inhibition and apoptosis in human multiple myeloma cells: A preliminary study.Bosn J Basic Med Sci. 2016 Nov 10;16(4):268-275. doi: 10.17305/bjbms.2016.1568.
23 Genetic association analyses implicate aberrant regulation of innate and adaptive immunity genes in the pathogenesis of systemic lupus erythematosus.Nat Genet. 2015 Dec;47(12):1457-1464. doi: 10.1038/ng.3434. Epub 2015 Oct 26.
24 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
25 Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
26 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
27 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
28 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
29 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
30 The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
31 Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
32 Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
33 Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
34 Bone marrow osteoblast damage by chemotherapeutic agents. PLoS One. 2012;7(2):e30758. doi: 10.1371/journal.pone.0030758. Epub 2012 Feb 17.
35 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
36 Expression profiling in squamous carcinoma cells reveals pleiotropic effects of vitamin D3 analog EB1089 signaling on cell proliferation, differentiation, and immune system regulation. Mol Endocrinol. 2002 Jun;16(6):1243-56.
37 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
38 BET bromodomain inhibition as a therapeutic strategy to target c-Myc. Cell. 2011 Sep 16;146(6):904-17.
39 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
40 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.