Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTIXMUVL)

DOT Name Extracellular sulfatase Sulf-2 (SULF2)
Synonyms hSulf-2; Arylsulfatase; EC 3.1.6.1; N-acetylglucosamine-6-sulfatase; EC 3.1.6.14
Gene Name SULF2
UniProt ID
SULF2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
3.1.6.1; 3.1.6.14
Pfam ID
PF12548 ; PF00884
Sequence
MGPPSLVLCLLSATVFSLLGGSSAFLSHHRLKGRFQRDRRNIRPNIILVLTDDQDVELGS
MQVMNKTRRIMEQGGAHFINAFVTTPMCCPSRSSILTGKYVHNHNTYTNNENCSSPSWQA
QHESRTFAVYLNSTGYRTAFFGKYLNEYNGSYVPPGWKEWVGLLKNSRFYNYTLCRNGVK
EKHGSDYSKDYLTDLITNDSVSFFRTSKKMYPHRPVLMVISHAAPHGPEDSAPQYSRLFP
NASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQRKRLQTLMSVDDSMETIYNM
LVETGELDNTYIVYTADHGYHIGQFGLVKGKSMPYEFDIRVPFYVRGPNVEAGCLNPHIV
LNIDLAPTILDIAGLDIPADMDGKSILKLLDTERPVNRFHLKKKMRVWRDSFLVERGKLL
HKRDNDKVDAQEENFLPKYQRVKDLCQRAEYQTACEQLGQKWQCVEDATGKLKLHKCKGP
MRLGGSRALSNLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRSIRSV
AIEVDGRVYHVGLGDAAQPRNLTKRHWPGAPEDQDDKDGGDFSGTGGLPDYSAANPIKVT
HRCYILENDTVQCDLDLYKSLQAWKDHKLHIDHEIETLQNKIKNLREVRGHLKKKRPEEC
DCHKISYHTQHKGRLKHRGSSLHPFRKGLQEKDKVWLLREQKRKKKLRKLLKRLQNNDTC
SMPGLTCFTHDNQHWQTAPFWTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLE
YFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPRTRNMDLGLKDGGSYE
QYRQFQRRKWPEMKRPSSKSLGQLWEGWEG
Function Exhibits arylsulfatase activity and highly specific endoglucosamine-6-sulfatase activity. It can remove sulfate from the C-6 position of glucosamine within specific subregions of intact heparin.
Tissue Specificity Expressed at highest levels in the ovary, skeletal muscle, stomach, brain, uterus, heart, kidney and placenta.

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
37 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Extracellular sulfatase Sulf-2 (SULF2). [1]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Extracellular sulfatase Sulf-2 (SULF2). [2]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Extracellular sulfatase Sulf-2 (SULF2). [3]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Extracellular sulfatase Sulf-2 (SULF2). [4]
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of Extracellular sulfatase Sulf-2 (SULF2). [5]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Extracellular sulfatase Sulf-2 (SULF2). [6]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Extracellular sulfatase Sulf-2 (SULF2). [7]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Extracellular sulfatase Sulf-2 (SULF2). [8]
Quercetin DM3NC4M Approved Quercetin increases the expression of Extracellular sulfatase Sulf-2 (SULF2). [9]
Temozolomide DMKECZD Approved Temozolomide increases the expression of Extracellular sulfatase Sulf-2 (SULF2). [10]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of Extracellular sulfatase Sulf-2 (SULF2). [11]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Extracellular sulfatase Sulf-2 (SULF2). [12]
Testosterone DM7HUNW Approved Testosterone decreases the expression of Extracellular sulfatase Sulf-2 (SULF2). [12]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Extracellular sulfatase Sulf-2 (SULF2). [13]
Decitabine DMQL8XJ Approved Decitabine affects the expression of Extracellular sulfatase Sulf-2 (SULF2). [14]
Zoledronate DMIXC7G Approved Zoledronate increases the expression of Extracellular sulfatase Sulf-2 (SULF2). [7]
Phenobarbital DMXZOCG Approved Phenobarbital affects the expression of Extracellular sulfatase Sulf-2 (SULF2). [15]
Progesterone DMUY35B Approved Progesterone increases the expression of Extracellular sulfatase Sulf-2 (SULF2). [16]
Demecolcine DMCZQGK Approved Demecolcine increases the expression of Extracellular sulfatase Sulf-2 (SULF2). [17]
Rosiglitazone DMILWZR Approved Rosiglitazone decreases the expression of Extracellular sulfatase Sulf-2 (SULF2). [7]
Dasatinib DMJV2EK Approved Dasatinib increases the expression of Extracellular sulfatase Sulf-2 (SULF2). [18]
Cidofovir DMA13GD Approved Cidofovir decreases the expression of Extracellular sulfatase Sulf-2 (SULF2). [7]
Fenofibrate DMFKXDY Approved Fenofibrate decreases the expression of Extracellular sulfatase Sulf-2 (SULF2). [7]
Ifosfamide DMCT3I8 Approved Ifosfamide decreases the expression of Extracellular sulfatase Sulf-2 (SULF2). [7]
Clodronate DM9Y6X7 Approved Clodronate decreases the expression of Extracellular sulfatase Sulf-2 (SULF2). [7]
Ibuprofen DM8VCBE Approved Ibuprofen decreases the expression of Extracellular sulfatase Sulf-2 (SULF2). [7]
Lucanthone DMZLBUO Approved Lucanthone increases the expression of Extracellular sulfatase Sulf-2 (SULF2). [19]
Adefovir dipivoxil DMMAWY1 Approved Adefovir dipivoxil increases the expression of Extracellular sulfatase Sulf-2 (SULF2). [7]
Cholecalciferol DMGU74E Approved Cholecalciferol affects the expression of Extracellular sulfatase Sulf-2 (SULF2). [20]
Resveratrol DM3RWXL Phase 3 Resveratrol increases the expression of Extracellular sulfatase Sulf-2 (SULF2). [21]
Genistein DM0JETC Phase 2/3 Genistein increases the expression of Extracellular sulfatase Sulf-2 (SULF2). [22]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Extracellular sulfatase Sulf-2 (SULF2). [8]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Extracellular sulfatase Sulf-2 (SULF2). [23]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Extracellular sulfatase Sulf-2 (SULF2). [24]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Extracellular sulfatase Sulf-2 (SULF2). [25]
Coumestrol DM40TBU Investigative Coumestrol increases the expression of Extracellular sulfatase Sulf-2 (SULF2). [26]
Sulforaphane DMQY3L0 Investigative Sulforaphane increases the expression of Extracellular sulfatase Sulf-2 (SULF2). [27]
------------------------------------------------------------------------------------
⏷ Show the Full List of 37 Drug(s)

References

1 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
3 Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
4 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
5 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
6 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
7 Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
8 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
9 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
10 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
11 Chronic occupational exposure to arsenic induces carcinogenic gene signaling networks and neoplastic transformation in human lung epithelial cells. Toxicol Appl Pharmacol. 2012 Jun 1;261(2):204-16.
12 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
13 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
14 Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
15 Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
16 Unique transcriptome, pathways, and networks in the human endometrial fibroblast response to progesterone in endometriosis. Biol Reprod. 2011 Apr;84(4):801-15.
17 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
18 Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
19 Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
20 Targeting iron homeostasis induces cellular differentiation and synergizes with differentiating agents in acute myeloid leukemia. J Exp Med. 2010 Apr 12;207(4):731-50. doi: 10.1084/jem.20091488. Epub 2010 Apr 5.
21 A novel long noncoding RNA AK001796 acts as an oncogene and is involved in cell growth inhibition by resveratrol in lung cancer. Toxicol Appl Pharmacol. 2015 Jun 1;285(2):79-88.
22 The molecular basis of genistein-induced mitotic arrest and exit of self-renewal in embryonal carcinoma and primary cancer cell lines. BMC Med Genomics. 2008 Oct 10;1:49.
23 Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
24 Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
25 Regulation of chromatin assembly and cell transformation by formaldehyde exposure in human cells. Environ Health Perspect. 2017 Sep 21;125(9):097019.
26 Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
27 Sulforaphane-induced apoptosis in human leukemia HL-60 cells through extrinsic and intrinsic signal pathways and altering associated genes expression assayed by cDNA microarray. Environ Toxicol. 2017 Jan;32(1):311-328.