Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKLBLS6)

• DOT Name: Nidogen-1 (NID1)
• Synonyms: NID-1; Entactin
• Gene Name: NID1
• Related Disease:
  Diabetic retinopathy
  Melanoma
  Advanced cancer
  Breast cancer
  Colon cancer
  Colon carcinoma
  Constipation
  Endometrial cancer
  Endometrial carcinoma
  Epithelial ovarian cancer
  Gastric cancer
  Hirschsprung disease
  Neoplasm
  Non-small-cell lung cancer
  Oral cavity squamous cell carcinoma
  Ovarian cancer
  Ovarian neoplasm
  Dandy-Walker syndrome
  Breast carcinoma
  Ileus
  Melanocytic nevus
  Prostate cancer
  Prostate carcinoma
  Squamous cell carcinoma
• UniProt ID: NID1_HUMAN
• Pfam ID: PF12662 ; PF12947 ; PF07645 ; PF14670 ; PF07474 ; PF00058 ; PF06119 ; PF00086
• Sequence:
  MLASSSRIRAAWTRALLLPLLLAGPVGCLSRQELFPFGPGQGDLELEDGDDFVSPALELS
  GALRFYDRSDIDAVYVTTNGIIATSEPPAKESHPGLFPPTFGAVAPFLADLDTTDGLGKV
  YYREDLSPSITQRAAECVHRGFPEISFQPSSAVVVTWESVAPYQGPSRDPDQKGKRNTFQ
  AVLASSDSSSYAIFLYPEDGLQFHTTFSKKENNQVPAVVAFSQGSVGFLWKSNGAYNIFA
  NDRESVENLAKSSNSGQQGVWVFEIGSPATTNGVVPADVILGTEDGAEYDDEDEDYDLAT
  TRLGLEDVGTTPFSYKALRRGGADTYSVPSVLSPRRAATERPLGPPTERTRSFQLAVETF
  HQQHPQVIDVDEVEETGVVFSYNTDSRQTCANNRHQCSVHAECRDYATGFCCSCVAGYTG
  NGRQCVAEGSPQRVNGKVKGRIFVGSSQVPIVFENTDLHSYVVMNHGRSYTAISTIPETV
  GYSLLPLAPVGGIIGWMFAVEQDGFKNGFSITGGEFTRQAEVTFVGHPGNLVIKQRFSGI
  DEHGHLTIDTELEGRVPQIPFGSSVHIEPYTELYHYSTSVITSSSTREYTVTEPERDGAS
  PSRIYTYQWRQTITFQECVHDDSRPALPSTQQLSVDSVFVLYNQEEKILRYALSNSIGPV
  REGSPDALQNPCYIGTHGCDTNAACRPGPRTQFTCECSIGFRGDGRTCYDIDECSEQPSV
  CGSHTICNNHPGTFRCECVEGYQFSDEGTCVAVVDQRPINYCETGLHNCDIPQRAQCIYT
  GGSSYTCSCLPGFSGDGQACQDVDECQPSRCHPDAFCYNTPGSFTCQCKPGYQGDGFRCV
  PGEVEKTRCQHEREHILGAAGATDPQRPIPPGLFVPECDAHGHYAPTQCHGSTGYCWCVD
  RDGREVEGTRTRPGMTPPCLSTVAPPIHQGPAVPTAVIPLPPGTHLLFAQTGKIERLPLE
  GNTMRKTEAKAFLHVPAKVIIGLAFDCVDKMVYWTDITEPSIGRASLHGGEPTTIIRQDL
  GSPEGIAVDHLGRNIFWTDSNLDRIEVAKLDGTQRRVLFETDLVNPRGIVTDSVRGNLYW
  TDWNRDNPKIETSYMDGTNRRILVQDDLGLPNGLTFDAFSSQLCWVDAGTNRAECLNPSQ
  PSRRKALEGLQYPFAVTSYGKNLYFTDWKMNSVVALDLAISKETDAFQPHKQTRLYGITT
  ALSQCPQGHNYCSVNNGGCTHLCLATPGSRTCRCPDNTLGVDCIEQK
• Function: Sulfated glycoprotein widely distributed in basement membranes and tightly associated with laminin. Also binds to collagen IV and perlecan. It probably has a role in cell-extracellular matrix interactions.
• KEGG Pathway: Cytoskeleton in muscle cells (hsa04820)
• Reactome Pathway:
  Laminin interactions (R-HSA-3000157)
  Degradation of the extracellular matrix (R-HSA-1474228)

Molecular Interaction Atlas (MIA) of This DOT

24 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Diabetic retinopathy	DISHGUJM	Definitive	Biomarker	[1]
Melanoma	DIS1RRCY	Definitive	Genetic Variation	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Breast cancer	DIS7DPX1	Strong	Biomarker	[4]
Colon cancer	DISVC52G	Strong	Posttranslational Modification	[5]
Colon carcinoma	DISJYKUO	Strong	Posttranslational Modification	[5]
Constipation	DISRQXWI	Strong	Genetic Variation	[6]
Endometrial cancer	DISW0LMR	Strong	Biomarker	[7]
Endometrial carcinoma	DISXR5CY	Strong	Biomarker	[7]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[8]
Gastric cancer	DISXGOUK	Strong	Posttranslational Modification	[5]
Hirschsprung disease	DISUUSM1	Strong	Biomarker	[9]
Neoplasm	DISZKGEW	Strong	Altered Expression	[10]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[3]
Oral cavity squamous cell carcinoma	DISQVJVA	Strong	Altered Expression	[11]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[8]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[8]
Dandy-Walker syndrome	DIS4HC6W	moderate	Biomarker	[12]
Breast carcinoma	DIS2UE88	Limited	Biomarker	[4]
Ileus	DISH7JW9	Limited	Biomarker	[13]
Melanocytic nevus	DISYS32D	Limited	Genetic Variation	[2]
Prostate cancer	DISF190Y	Limited	Biomarker	[14]
Prostate carcinoma	DISMJPLE	Limited	Biomarker	[14]
Squamous cell carcinoma	DISQVIFL	Limited	Altered Expression	[10]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Cyclophosphamide	DM4O2Z7	Approved	Nidogen-1 (NID1) affects the response to substance of Cyclophosphamide.	[36]

19 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Nidogen-1 (NID1).	[15]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Nidogen-1 (NID1).	[16]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Nidogen-1 (NID1).	[17]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Nidogen-1 (NID1).	[18]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Nidogen-1 (NID1).	[19]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Nidogen-1 (NID1).	[20]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Nidogen-1 (NID1).	[21]
Arsenic	DMTL2Y1	Approved	Arsenic affects the expression of Nidogen-1 (NID1).	[22]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Nidogen-1 (NID1).	[23]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Nidogen-1 (NID1).	[24]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Nidogen-1 (NID1).	[25]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Nidogen-1 (NID1).	[26]
Hydroquinone	DM6AVR4	Approved	Hydroquinone decreases the expression of Nidogen-1 (NID1).	[27]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone affects the expression of Nidogen-1 (NID1).	[28]
Irinotecan	DMP6SC2	Approved	Irinotecan increases the expression of Nidogen-1 (NID1).	[29]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Nidogen-1 (NID1).	[30]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Nidogen-1 (NID1).	[33]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Nidogen-1 (NID1).	[34]
Bilirubin	DMI0V4O	Investigative	Bilirubin decreases the expression of Nidogen-1 (NID1).	[35]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Nidogen-1 (NID1).	[31]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Nidogen-1 (NID1).	[32]

References

• [1] Overexpression of matrix metalloproteinase-10 and matrix metalloproteinase-3 in human diabetic corneas: a possible mechanism of basement membrane and integrin alterations.Am J Pathol. 2001 Feb;158(2):723-34. doi: 10.1016/S0002-9440(10)64015-1.
• [2] Higher Nevus Count Exhibits a Distinct DNA Methylation Signature in Healthy Human Skin: Implications for Melanoma.J Invest Dermatol. 2017 Apr;137(4):910-920. doi: 10.1016/j.jid.2016.11.029. Epub 2016 Dec 18.
• [3] Nidogen-1 Degraded by Cathepsin S can be Quantified in Serum and is Associated with Non-Small Cell Lung Cancer.Neoplasia. 2017 Apr;19(4):271-278. doi: 10.1016/j.neo.2017.01.008. Epub 2017 Mar 7.
• [4] Identification of Nidogen 1 as a lung metastasis protein through secretome analysis.Genes Dev. 2017 Jul 15;31(14):1439-1455. doi: 10.1101/gad.301937.117. Epub 2017 Aug 21.
• [5] Nidogen 1 and 2 gene promoters are aberrantly methylated in human gastrointestinal cancer.Mol Cancer. 2007 Feb 28;6:17. doi: 10.1186/1476-4598-6-17.
• [6] Neuronal intestinal dysplasia: clinical experience in Italian patients.Eur J Pediatr Surg. 1994 Oct;4(5):287-92. doi: 10.1055/s-2008-1066119.
• [7] Nidogen 1 and Nuclear Protein 1: novel targets of ETV5 transcription factor involved in endometrial cancer invasion.Clin Exp Metastasis. 2015 Jun;32(5):467-78. doi: 10.1007/s10585-015-9720-7. Epub 2015 Apr 30.
• [8] NID1, a new regulator of EMT required for metastasis and chemoresistance of ovarian cancer cells.Oncotarget. 2017 May 16;8(20):33110-33121. doi: 10.18632/oncotarget.16145.
• [9] Nidogen-1 is a common target of microRNAs MiR-192/215 in the pathogenesis of Hirschsprung's disease.J Neurochem. 2015 Jul;134(1):39-46. doi: 10.1111/jnc.13118. Epub 2015 May 4.
• [10] Enhanced expression of nidogen 1 around the nest of basal cell carcinoma compared with that around squamous cell carcinoma.Med Mol Morphol. 2019 Jun;52(2):99-105. doi: 10.1007/s00795-018-0207-x. Epub 2018 Oct 1.
• [11] Proteomic Profiling of Paired Interstitial Fluids Reveals Dysregulated Pathways and Salivary NID1 as a Biomarker of Oral Cavity Squamous Cell Carcinoma.Mol Cell Proteomics. 2019 Oct;18(10):1939-1949. doi: 10.1074/mcp.RA119.001654. Epub 2019 Jul 17.
• [12] NID1 variant associated with occipital cephaloceles in a family expressing a spectrum of phenotypes.Am J Med Genet A. 2019 May;179(5):837-841. doi: 10.1002/ajmg.a.61095. Epub 2019 Feb 17.
• [13] Neuronal intestinal malformations: a retro- and prospective study on 203 patients.Eur J Pediatr Surg. 1994 Oct;4(5):279-86. doi: 10.1055/s-2008-1066118.
• [14] Androgen-Induced TMPRSS2 Activates Matriptase and Promotes Extracellular Matrix Degradation, Prostate Cancer Cell Invasion, Tumor Growth, and Metastasis.Cancer Res. 2015 Jul 15;75(14):2949-60. doi: 10.1158/0008-5472.CAN-14-3297. Epub 2015 May 27.
• [15] Design principles of concentration-dependent transcriptome deviations in drug-exposed differentiating stem cells. Chem Res Toxicol. 2014 Mar 17;27(3):408-20.
• [16] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [17] Constitutive gene expression predisposes morphogen-mediated cell fate responses of NT2/D1 and 27X-1 human embryonal carcinoma cells. Stem Cells. 2007 Mar;25(3):771-8. doi: 10.1634/stemcells.2006-0271. Epub 2006 Nov 30.
• [18] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [19] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [20] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [21] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [22] Prenatal arsenic exposure and shifts in the newborn proteome: interindividual differences in tumor necrosis factor (TNF)-responsive signaling. Toxicol Sci. 2014 Jun;139(2):328-37. doi: 10.1093/toxsci/kfu053. Epub 2014 Mar 27.
• [23] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [24] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [25] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [26] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [27] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [28] Proteomic analysis of human adipose tissue after rosiglitazone treatment shows coordinated changes to promote glucose uptake. Obesity (Silver Spring). 2010 Jan;18(1):27-34. doi: 10.1038/oby.2009.208. Epub 2009 Jun 25.
• [29] In vitro and in vivo irinotecan-induced changes in expression profiles of cell cycle and apoptosis-associated genes in acute myeloid leukemia cells. Mol Cancer Ther. 2005 Jun;4(6):885-900.
• [30] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [31] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [32] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [33] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [34] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [35] Global changes in gene regulation demonstrate that unconjugated bilirubin is able to upregulate and activate select components of the endoplasmic reticulum stress response pathway. J Biochem Mol Toxicol. 2010 Mar-Apr;24(2):73-88.
• [36] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.