Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTO46S5S)

DOT Name Leukemia inhibitory factor (LIF)
Synonyms LIF; Differentiation-stimulating factor; D factor; Melanoma-derived LPL inhibitor; MLPLI; Emfilermin
Gene Name LIF
UniProt ID
LIF_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1EMR; 1PVH; 2Q7N; 7N0A; 8D6A
Pfam ID
PF01291
Sequence
MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSAN
ALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNIT
RDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQK
KKLGCQLLGKYKQIIAVLAQAF
Function
LIF has the capacity to induce terminal differentiation in leukemic cells. Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes.
KEGG Pathway
Cytokine-cytokine receptor interaction (hsa04060 )
Sig.ling pathways regulating pluripotency of stem cells (hsa04550 )
JAK-STAT sig.ling pathway (hsa04630 )
TNF sig.ling pathway (hsa04668 )
Reactome Pathway
Interleukin-4 and Interleukin-13 signaling (R-HSA-6785807 )
IL-6-type cytokine receptor ligand interactions (R-HSA-6788467 )
Interleukin-10 signaling (R-HSA-6783783 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 2 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Temozolomide DMKECZD Approved Leukemia inhibitory factor (LIF) increases the response to substance of Temozolomide. [42]
DTI-015 DMXZRW0 Approved Leukemia inhibitory factor (LIF) increases the response to substance of DTI-015. [42]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Leukemia inhibitory factor (LIF). [1]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Leukemia inhibitory factor (LIF). [33]
------------------------------------------------------------------------------------
48 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Leukemia inhibitory factor (LIF). [2]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Leukemia inhibitory factor (LIF). [3]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Leukemia inhibitory factor (LIF). [4]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Leukemia inhibitory factor (LIF). [5]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Leukemia inhibitory factor (LIF). [6]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Leukemia inhibitory factor (LIF). [7]
Quercetin DM3NC4M Approved Quercetin increases the expression of Leukemia inhibitory factor (LIF). [8]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of Leukemia inhibitory factor (LIF). [9]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide increases the expression of Leukemia inhibitory factor (LIF). [10]
Triclosan DMZUR4N Approved Triclosan increases the expression of Leukemia inhibitory factor (LIF). [11]
Methotrexate DM2TEOL Approved Methotrexate increases the expression of Leukemia inhibitory factor (LIF). [12]
Decitabine DMQL8XJ Approved Decitabine increases the expression of Leukemia inhibitory factor (LIF). [13]
Marinol DM70IK5 Approved Marinol decreases the expression of Leukemia inhibitory factor (LIF). [14]
Menadione DMSJDTY Approved Menadione increases the expression of Leukemia inhibitory factor (LIF). [10]
Dexamethasone DMMWZET Approved Dexamethasone decreases the expression of Leukemia inhibitory factor (LIF). [15]
Demecolcine DMCZQGK Approved Demecolcine increases the expression of Leukemia inhibitory factor (LIF). [16]
Cannabidiol DM0659E Approved Cannabidiol increases the expression of Leukemia inhibitory factor (LIF). [17]
Troglitazone DM3VFPD Approved Troglitazone increases the expression of Leukemia inhibitory factor (LIF). [18]
Azathioprine DMMZSXQ Approved Azathioprine increases the expression of Leukemia inhibitory factor (LIF). [19]
Ethanol DMDRQZU Approved Ethanol increases the expression of Leukemia inhibitory factor (LIF). [20]
Etoposide DMNH3PG Approved Etoposide increases the expression of Leukemia inhibitory factor (LIF). [21]
Sodium lauryl sulfate DMLJ634 Approved Sodium lauryl sulfate decreases the expression of Leukemia inhibitory factor (LIF). [22]
Malathion DMXZ84M Approved Malathion increases the expression of Leukemia inhibitory factor (LIF). [23]
Lindane DMB8CNL Approved Lindane increases the expression of Leukemia inhibitory factor (LIF). [24]
Ritonavir DMU764S Approved Ritonavir decreases the expression of Leukemia inhibitory factor (LIF). [25]
Chlorambucil DMRKE63 Approved Chlorambucil increases the expression of Leukemia inhibitory factor (LIF). [24]
Letrozole DMH07Y3 Approved Letrozole increases the expression of Leukemia inhibitory factor (LIF). [26]
Benzyl alcohol DMBVYDI Approved Benzyl alcohol increases the expression of Leukemia inhibitory factor (LIF). [22]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Leukemia inhibitory factor (LIF). [27]
Isoflavone DM7U58J Phase 4 Isoflavone affects the expression of Leukemia inhibitory factor (LIF). [28]
Resveratrol DM3RWXL Phase 3 Resveratrol increases the expression of Leukemia inhibitory factor (LIF). [29]
Genistein DM0JETC Phase 2/3 Genistein decreases the expression of Leukemia inhibitory factor (LIF). [30]
Amiodarone DMUTEX3 Phase 2/3 Trial Amiodarone increases the expression of Leukemia inhibitory factor (LIF). [31]
phorbol 12-myristate 13-acetate DMJWD62 Phase 2 phorbol 12-myristate 13-acetate increases the expression of Leukemia inhibitory factor (LIF). [24]
OTX-015 DMI8RG1 Phase 1/2 OTX-015 decreases the expression of Leukemia inhibitory factor (LIF). [32]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Leukemia inhibitory factor (LIF). [34]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide increases the expression of Leukemia inhibitory factor (LIF). [35]
Mivebresib DMCPF90 Phase 1 Mivebresib decreases the expression of Leukemia inhibitory factor (LIF). [32]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Leukemia inhibitory factor (LIF). [36]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of Leukemia inhibitory factor (LIF). [16]
Glyphosate DM0AFY7 Investigative Glyphosate increases the expression of Leukemia inhibitory factor (LIF). [37]
D-glucose DMMG2TO Investigative D-glucose increases the expression of Leukemia inhibitory factor (LIF). [38]
geraniol DMS3CBD Investigative geraniol decreases the expression of Leukemia inhibitory factor (LIF). [22]
Phencyclidine DMQBEYX Investigative Phencyclidine increases the expression of Leukemia inhibitory factor (LIF). [39]
OXYQUINOLINE DMZVS9Y Investigative OXYQUINOLINE increases the expression of Leukemia inhibitory factor (LIF). [24]
Resorcinol DMM37C0 Investigative Resorcinol increases the expression of Leukemia inhibitory factor (LIF). [24]
Bilirubin DMI0V4O Investigative Bilirubin increases the expression of Leukemia inhibitory factor (LIF). [40]
Calyculin-A DMY29Q8 Investigative Calyculin-A decreases the expression of Leukemia inhibitory factor (LIF). [41]
------------------------------------------------------------------------------------
⏷ Show the Full List of 48 Drug(s)

References

1 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2 Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
3 Effect of retinoic acid on gene expression in human conjunctival epithelium: secretory phospholipase A2 mediates retinoic acid induction of MUC16. Invest Ophthalmol Vis Sci. 2005 Nov;46(11):4050-61.
4 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
7 Persistent and non-persistent changes in gene expression result from long-term estrogen exposure of MCF-7 breast cancer cells. J Steroid Biochem Mol Biol. 2011 Feb;123(3-5):140-50.
8 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
9 Arsenic trioxide induces differentiation of cancer stem cells in hepatocellular carcinoma through inhibition of LIF/JAK1/STAT3 and NF-kB signaling pathways synergistically. Clin Transl Med. 2021 Feb;11(2):e335. doi: 10.1002/ctm2.335.
10 Gene expression after treatment with hydrogen peroxide, menadione, or t-butyl hydroperoxide in breast cancer cells. Cancer Res. 2002 Nov 1;62(21):6246-54.
11 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
12 Functional gene expression profile underlying methotrexate-induced senescence in human colon cancer cells. Tumour Biol. 2011 Oct;32(5):965-76.
13 Decitabine up-regulates S100A2 expression and synergizes with IFN-gamma to kill uveal melanoma cells. Clin Cancer Res. 2007 Sep 1;13(17):5219-25. doi: 10.1158/1078-0432.CCR-07-0816.
14 THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
15 Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
16 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
17 Cannabidiol enhances cytotoxicity of anti-cancer drugs in human head and neck squamous cell carcinoma. Sci Rep. 2020 Nov 26;10(1):20622. doi: 10.1038/s41598-020-77674-y.
18 Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
19 A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
20 Use of transcriptomics in hazard identification and next generation risk assessment: A case study with clothianidin. Food Chem Toxicol. 2022 Aug;166:113212. doi: 10.1016/j.fct.2022.113212. Epub 2022 Jun 8.
21 Cell death mechanisms of the anti-cancer drug etoposide on human cardiomyocytes isolated from pluripotent stem cells. Arch Toxicol. 2018 Apr;92(4):1507-1524.
22 A comparative study of leukaemia inhibitory factor and interleukin-1alpha intracellular content in a human keratinocyte cell line after exposure to cosmetic fragrances and sodium dodecyl sulphate. Toxicol Lett. 2010 Feb 1;192(2):101-7. doi: 10.1016/j.toxlet.2009.10.013. Epub 2009 Oct 28.
23 Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
24 Oxidative stress mechanisms do not discriminate between genotoxic and nongenotoxic liver carcinogens. Chem Res Toxicol. 2015 Aug 17;28(8):1636-46.
25 Transcriptional profiling suggests that Nevirapine and Ritonavir cause drug induced liver injury through distinct mechanisms in primary human hepatocytes. Chem Biol Interact. 2016 Aug 5;255:31-44.
26 Clomiphene citrate versus letrozole: molecular analysis of the endometrium in women with polycystic ovary syndrome. Fertil Steril. 2011 Oct;96(4):1051-6. doi: 10.1016/j.fertnstert.2011.07.1092.
27 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
28 Soy isoflavones alter expression of genes associated with cancer progression, including interleukin-8, in androgen-independent PC-3 human prostate cancer cells. J Nutr. 2006 Jan;136(1):75-82.
29 Inhibition of STAT3 expression and signaling in resveratrol-differentiated medulloblastoma cells. Neoplasia. 2008 Jul;10(7):736-44. doi: 10.1593/neo.08304.
30 Genistein disrupts glucocorticoid receptor signaling in human uterine endometrial Ishikawa cells. Environ Health Perspect. 2015 Jan;123(1):80-7. doi: 10.1289/ehp.1408437. Epub 2014 Aug 19.
31 Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
32 Comprehensive transcriptome profiling of BET inhibitor-treated HepG2 cells. PLoS One. 2022 Apr 29;17(4):e0266966. doi: 10.1371/journal.pone.0266966. eCollection 2022.
33 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
34 Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
35 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
36 Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
37 Glyphosate-based herbicides at low doses affect canonical pathways in estrogen positive and negative breast cancer cell lines. PLoS One. 2019 Jul 11;14(7):e0219610. doi: 10.1371/journal.pone.0219610. eCollection 2019.
38 High ambient glucose augments angiotensin II-induced proinflammatory gene mRNA expression in human mesangial cells: effects of valsartan and simvastatin. Am J Nephrol. 2009;30(2):99-111.
39 Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.
40 Global changes in gene regulation demonstrate that unconjugated bilirubin is able to upregulate and activate select components of the endoplasmic reticulum stress response pathway. J Biochem Mol Toxicol. 2010 Mar-Apr;24(2):73-88.
41 Calyculin A reveals serine/threonine phosphatase protein phosphatase 1 as a regulatory nodal point in canonical signal transducer and activator of transcription 3 signaling of human microvascular endothelial cells. J Interferon Cytokine Res. 2012 Feb;32(2):87-94. doi: 10.1089/jir.2011.0059. Epub 2011 Dec 5.
42 Tumor necrosis factor-alpha-induced protein 3 as a putative regulator of nuclear factor-kappaB-mediated resistance to O6-alkylating agents in human glioblastomas. J Clin Oncol. 2006 Jan 10;24(2):274-87. doi: 10.1200/JCO.2005.02.9405. Epub 2005 Dec 19.