General Information of Drug Off-Target (DOT) (ID: OTPPVRGY)

DOT Name PDZ domain-containing protein 2 (PDZD2)
Synonyms Activated in prostate cancer protein; PDZ domain-containing protein 3
Gene Name PDZD2
Related Disease
Alzheimer disease ( )
Bone osteosarcoma ( )
Cholangitis ( )
Inflammation ( )
Insulinoma ( )
Major depressive disorder ( )
Neoplasm ( )
Osteosarcoma ( )
Pancreatitis ( )
Primary biliary cholangitis ( )
Primary sclerosing cholangitis ( )
Prostate cancer ( )
Prostate carcinoma ( )
Prostate neoplasm ( )
Renal cell carcinoma ( )
Acute myelogenous leukaemia ( )
Clear cell renal carcinoma ( )
Myocardial infarction ( )
Chronic obstructive pulmonary disease ( )
UniProt ID
PDZD2_HUMAN
Pfam ID
PF00595
Sequence
MPITQDNAVLHLPLLYQWLQNSLQEGGDGPEQRLCQAAIQKLQEYIQLNFAVDESTVPPD
HSPPEMEICTVYLTKELGDTETVGLSFGNIPVFGDYGEKRRGGKKRKTHQGPVLDVGCIW
VTELRKNSPAGKSGKVRLRDEILSLNGQLMVGVDVSGASYLAEQCWNGGFIYLIMLRRFK
HKAHSTYNGNSSNSSEPGETPTLELGDRTAKKGKRTRKFGVISRPPANKAPEESKGSAGC
EVSSDPSTELENGPDPELGNGHVFQLENGPDSLKEVAGPHLERSEVDRGTEHRIPKTDAP
LTTSNDKRRFSKGGKTDFQSSDCLAREEVGRIWKMELLKESDGLGIQVSGGRGSKRSPHA
IVVTQVKEGGAAHRDGRLSLGDELLVINGHLLVGLSHEEAVAILRSATGMVQLVVASKEN
SAEDLLRLTSKSLPDLTSSVEDVSSWTDNEDQEADGEEDEGTSSSVQRAMPGTDEPQDVC
GAEESKGNLESPKQGSNKIKLKSRLSGGVHRLESVEEYNELMVRNGDPRIRMLEVSRDGR
KHSLPQLLDSSSASQEYHIVKKSTRSLSTTQVESPWRLIRPSVISIIGLYKEKGKGLGFS
IAGGRDCIRGQMGIFVKTIFPNGSAAEDGRLKEGDEILDVNGIPIKGLTFQEAIHTFKQI
RSGLFVLTVRTKLVSPSLTPCSTPTHMSRSASPNFNTSGGASAGGSDEGSSSSLGRKTPG
PKDRIVMEVTLNKEPRVGLGIGACCLALENSPPGIYIHSLAPGSVAKMESNLSRGDQILE
VNSVNVRHAALSKVHAILSKCPPGPVRLVIGRHPNPKVSEQEMDEVIARSTYQESKEANS
SPGLGTPLKSPSLAKKDSLISESELSQYFAHDVPGPLSDFMVAGSEDEDHPGSGCSTSEE
GSLPPSTSTHKEPGKPRANSLVTLGSHRASGLFHKQVTVARQASLPGSPQALRNPLLRQR
KVGCYDANDASDEEEFDREGDCISLPGALPGPIRPLSEDDPRRVSISSSKGMDVHNQEER
PRKTLVSKAISAPLLGSSVDLEESIPEGMVDAASYAANLTDSAEAPKGSPGSWWKKELSG
SSSAPKLEYTVRTDTQSPTNTGSPSSPQQKSEGLGSRHRPVARVSPHCKRSEAEAKPSGS
QTVNLTGRANDPCDLDSRVQATSVKVTVAGFQPGGAVEKESLGKLTTGDACVSTSCELAS
ALSHLDASHLTENLPKAASELGQQPMTELDSSSDLISSPGKKGAAHPDPSKTSVDTGQVS
RPENPSQPASPRVTKCKARSPVRLPHEGSPSPGEKAAAPPDYSKTRSASETSTPHNTRRV
AALRGAGPGAEGMTPAGAVLPGDPLTSQEQRQGAPGNHSKALEMTGIHAPESSQEPSLLE
GADSVSSRAPQASLSMLPSTDNTKEACGHVSGHCCPGGSRESPVTDIDSFIKELDASAAR
SPSSQTGDSGSQEGSAQGHPPAGAGGGSSCRAEPVPGGQTSSPRRAWAAGAPAYPQWASQ
PSVLDSINPDKHFTVNKNFLSNYSRNFSSFHEDSTSLSGLGDSTEPSLSSMYGDAEDSSS
DPESLTEAPRASARDGWSPPRSRVSLHKEDPSESEEEQIEICSTRGCPNPPSSPAHLPTQ
AAICPASAKVLSLKYSTPRESVASPREKAACLPGSYTSGPDSSQPSSLLEMSSQEHETHA
DISTSQNHRPSCAEETTEVTSASSAMENSPLSKVARHFHSPPIILSSPNMVNGLEHDLLD
DETLNQYETSINAAASLSSFSVDVPKNGESVLENLHISESQDLDDLLQKPKMIARRPIMA
WFKEINKHNQGTHLRSKTEKEQPLMPARSPDSKIQMVSSSQKKGVTVPHSPPQPKTNLEN
KDLSKKSPAEMLLTNGQKAKCGPKLKRLSLKGKAKVNSEAPAANAVKAGGTDHRKPLISP
QTSHKTLSKAVSQRLHVADHEDPDRNTTAAPRSPQCVLESKPPLATSGPLKPSVSDTSIR
TFVSPLTSPKPVPEQGMWSRFHMAVLSEPDRGCPTTPKSPKCRAEGRAPRADSGPVSPAA
SRNGMSVAGNRQSEPRLASHVAADTAQPRPTGEKGGNIMASDRLERTNQLKIVEISAEAV
SETVCGNKPAESDRRGGCLAQGNCQEKSEIRLYRQVAESSTSHPSSLPSHASQAEQEMSR
SFSMAKLASSSSSLQTAIRKAEYSQGKSSLMSDSRGVPRNSIPGGPSGEDHLYFTPRPAT
RTYSMPAQFSSHFGREGHPPHSLGRSRDSQVPVTSSVVPEAKASRGGLPSLANGQGIYSV
KPLLDTSRNLPATDEGDIISVQETSCLVTDKIKVTRRHYCYEQNWPHESTSFFSVKQRIK
SFENLANADRPVAKSGASPFLSVSSKPPIGRRSSGSIVSGSLGHPGDAAARLLRRSLSSC
SENQSEAGTLLPQMAKSPSIMTLTISRQNPPETSSKGSDSELKKSLGPLGIPTPTMTLAS
PVKRNKSSVRHTQPSPVSRSKLQELRALSMPDLDKLCSEDYSAGPSAVLFKTELEITPRR
SPGPPAGGVSCPEKGGNRACPGGSGPKTSAAETPSSASDTGEAAQDLPFRRSWSVNLDQL
LVSAGDQQRLQSVLSSVGSKSTILTLIQEAKAQSENEEDVCFIVLNRKEGSGLGFSVAGG
TDVEPKSITVHRVFSQGAASQEGTMNRGDFLLSVNGASLAGLAHGNVLKVLHQAQLHKDA
LVVIKKGMDQPRPSARQEPPTANGKGLLSRKTIPLEPGIGRSVAVHDALCVEVLKTSAGL
GLSLDGGKSSVTGDGPLVIKRVYKGGAAEQAGIIEAGDEILAINGKPLVGLMHFDAWNIM
KSVPEGPVQLLIRKHRNSS
Tissue Specificity Isoform 2 is expressed (at protein level) in prostate and many prostate tumors.

Molecular Interaction Atlas (MIA) of This DOT

19 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Alzheimer disease DISF8S70 Strong Genetic Variation [1]
Bone osteosarcoma DIST1004 Strong Biomarker [2]
Cholangitis DIS9U3YN Strong Biomarker [3]
Inflammation DISJUQ5T Strong Biomarker [3]
Insulinoma DISIU1JS Strong Biomarker [2]
Major depressive disorder DIS4CL3X Strong Genetic Variation [4]
Neoplasm DISZKGEW Strong Altered Expression [2]
Osteosarcoma DISLQ7E2 Strong Biomarker [2]
Pancreatitis DIS0IJEF Strong Biomarker [3]
Primary biliary cholangitis DIS43E0O Strong Biomarker [3]
Primary sclerosing cholangitis DISTH5WJ Strong Biomarker [3]
Prostate cancer DISF190Y Strong Biomarker [5]
Prostate carcinoma DISMJPLE Strong Biomarker [5]
Prostate neoplasm DISHDKGQ Strong Altered Expression [6]
Renal cell carcinoma DISQZ2X8 Strong Genetic Variation [7]
Acute myelogenous leukaemia DISCSPTN moderate Genetic Variation [8]
Clear cell renal carcinoma DISBXRFJ moderate Genetic Variation [9]
Myocardial infarction DIS655KI moderate Genetic Variation [10]
Chronic obstructive pulmonary disease DISQCIRF Limited Genetic Variation [11]
------------------------------------------------------------------------------------
⏷ Show the Full List of 19 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
10 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of PDZ domain-containing protein 2 (PDZD2). [12]
Tretinoin DM49DUI Approved Tretinoin increases the expression of PDZ domain-containing protein 2 (PDZD2). [13]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of PDZ domain-containing protein 2 (PDZD2). [14]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of PDZ domain-containing protein 2 (PDZD2). [16]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of PDZ domain-containing protein 2 (PDZD2). [17]
Progesterone DMUY35B Approved Progesterone increases the expression of PDZ domain-containing protein 2 (PDZD2). [18]
Epigallocatechin gallate DMCGWBJ Phase 3 Epigallocatechin gallate increases the expression of PDZ domain-containing protein 2 (PDZD2). [19]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of PDZ domain-containing protein 2 (PDZD2). [22]
Sulforaphane DMQY3L0 Investigative Sulforaphane decreases the expression of PDZ domain-containing protein 2 (PDZD2). [23]
Nickel chloride DMI12Y8 Investigative Nickel chloride increases the expression of PDZ domain-containing protein 2 (PDZD2). [24]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Drug(s)
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of PDZ domain-containing protein 2 (PDZD2). [15]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of PDZ domain-containing protein 2 (PDZD2). [20]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of PDZ domain-containing protein 2 (PDZD2). [21]
------------------------------------------------------------------------------------

References

1 PIN-1 promoter polymorphisms in mild cognitive impairment and susceptibility to Alzheimer's disease: a preliminary report.Aging Clin Exp Res. 2007 Oct;19(5):406-9. doi: 10.1007/BF03324722.
2 miR-363 acts as a tumor suppressor in osteosarcoma cells by inhibiting PDZD2.Oncol Rep. 2019 May;41(5):2729-2738. doi: 10.3892/or.2019.7078. Epub 2019 Mar 19.
3 Th2 and regulatory immune reactions are increased in immunoglobin G4-related sclerosing pancreatitis and cholangitis.Hepatology. 2007 Jun;45(6):1538-46. doi: 10.1002/hep.21697.
4 Citalopram and escitalopram plasma drug and metabolite concentrations: genome-wide associations.Br J Clin Pharmacol. 2014 Aug;78(2):373-83. doi: 10.1111/bcp.12348.
5 Pre-clinical and clinical evaluation of estramustine, docetaxel and thalidomide combination in androgen-independent prostate cancer.BJU Int. 2007 May;99(5):1047-55. doi: 10.1111/j.1464-410X.2007.06763.x.
6 Activated in prostate cancer: a PDZ domain-containing protein highly expressed in human primary prostate tumors.Cancer Res. 2001 Mar 15;61(6):2390-4.
7 Common variation at 2q22.3 (ZEB2) influences the risk of renal cancer.Hum Mol Genet. 2013 Feb 15;22(4):825-31. doi: 10.1093/hmg/dds489. Epub 2012 Nov 25.
8 Genome-wide haplotype association study identify the FGFR2 gene as a risk gene for acute myeloid leukemia.Oncotarget. 2017 Jan 31;8(5):7891-7899. doi: 10.18632/oncotarget.13631.
9 Germline genetic variations in PDZD2 and ITPR2 genes are associated with clear cell renal cell carcinoma in Chinese population.Oncotarget. 2017 Apr 11;8(15):24196-24201. doi: 10.18632/oncotarget.6917.
10 A genome-wide association study reveals susceptibility loci for myocardial infarction/coronary artery disease in Saudi Arabs.Atherosclerosis. 2016 Feb;245:62-70. doi: 10.1016/j.atherosclerosis.2015.11.019. Epub 2015 Nov 22.
11 A Genome-Wide Association Study in Hispanics/Latinos Identifies Novel Signals for Lung Function. The Hispanic Community Health Study/Study of Latinos.Am J Respir Crit Care Med. 2018 Jul 15;198(2):208-219. doi: 10.1164/rccm.201707-1493OC.
12 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
13 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
14 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
15 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
16 Arsenic suppresses gene expression in promyelocytic leukemia cells partly through Sp1 oxidation. Blood. 2005 Jul 1;106(1):304-10.
17 Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
18 Progesterone regulation of implantation-related genes: new insights into the role of oestrogen. Cell Mol Life Sci. 2007 Apr;64(7-8):1009-32.
19 Comparative proteomics reveals concordant and discordant biochemical effects of caffeine versus epigallocatechin-3-gallate in human endothelial cells. Toxicol Appl Pharmacol. 2019 Sep 1;378:114621. doi: 10.1016/j.taap.2019.114621. Epub 2019 Jun 10.
20 Effect of aflatoxin B(1), benzo[a]pyrene, and methapyrilene on transcriptomic and epigenetic alterations in human liver HepaRG cells. Food Chem Toxicol. 2018 Nov;121:214-223. doi: 10.1016/j.fct.2018.08.034. Epub 2018 Aug 26.
21 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
22 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
23 Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
24 The contact allergen nickel triggers a unique inflammatory and proangiogenic gene expression pattern via activation of NF-kappaB and hypoxia-inducible factor-1alpha. J Immunol. 2007 Mar 1;178(5):3198-207.