Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPQ0KT9)

• DOT Name: Centromere protein V (CENPV)
• Synonyms: CENP-V; Nuclear protein p30; Proline-rich protein 6
• Gene Name: CENPV
• Related Disease:
  Acute myelogenous leukaemia
  Adult T-cell leukemia/lymphoma
  Advanced cancer
  Alzheimer disease
  Amyotrophic lateral sclerosis
  Ataxia-telangiectasia
  Chronic kidney disease
  Liposarcoma
  Lupus
  Polycystic kidney disease
  Retinitis pigmentosa
  Stroke
  Systemic lupus erythematosus
  Human T-lymphotropic virus 1 infectious disease
  Anxiety
  Anxiety disorder
  Cystitis
  Fetal growth restriction
  Toxoplasmosis
• UniProt ID: CENPV_HUMAN
• Pfam ID: PF04828
• Sequence:
  MRRSRSSAAAKLRGQKRSGASGASAAPAASAAAALAPSATRTRRSASQAGSKSQAVEKPP
  SEKPRLRRSSPRAQEEGPGEPPPPELALLPPPPPPPPTPATPTSSASNLDLGEQRERWET
  FQKRQKLTSEGAAKLLLDTFEYQGLVKHTGGCHCGAVRFEVWASADLHIFDCNCSICKKK
  QNRHFIVPASRFKLLKGAEHITTYTFNTHKAQHTFCKRCGVQSFYTPRSNPGGFGIAPHC
  LDEGTVRSMVTEEFNGSDWEKAMKEHKTIKNMSKE
• Function: Required for distribution of pericentromeric heterochromatin in interphase nuclei and for centromere formation and organization, chromosome alignment and cytokinesis.

Molecular Interaction Atlas (MIA) of This DOT

19 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acute myelogenous leukaemia	DISCSPTN	Strong	Altered Expression	[1]
Adult T-cell leukemia/lymphoma	DIS882XU	Strong	Biomarker	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Alzheimer disease	DISF8S70	Strong	Biomarker	[4]
Amyotrophic lateral sclerosis	DISF7HVM	Strong	Genetic Variation	[5]
Ataxia-telangiectasia	DISP3EVR	Strong	Biomarker	[6]
Chronic kidney disease	DISW82R7	Strong	Biomarker	[7]
Liposarcoma	DIS8IZVM	Strong	Biomarker	[8]
Lupus	DISOKJWA	Strong	Biomarker	[9]
Polycystic kidney disease	DISWS3UY	Strong	Altered Expression	[10]
Retinitis pigmentosa	DISCGPY8	Strong	Biomarker	[11]
Stroke	DISX6UHX	Strong	Biomarker	[12]
Systemic lupus erythematosus	DISI1SZ7	Strong	Biomarker	[9]
Human T-lymphotropic virus 1 infectious disease	DISN5C4M	Disputed	Biomarker	[13]
Anxiety	DISIJDBA	Limited	Altered Expression	[14]
Anxiety disorder	DISBI2BT	Limited	Altered Expression	[14]
Cystitis	DIS2D4B9	Limited	Biomarker	[15]
Fetal growth restriction	DIS5WEJ5	Limited	Biomarker	[16]
Toxoplasmosis	DISYP8FH	Limited	Biomarker	[17]

5 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Centromere protein V (CENPV).	[18]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Centromere protein V (CENPV).	[29]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Centromere protein V (CENPV).	[30]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Centromere protein V (CENPV).	[31]
Coumarin	DM0N8ZM	Investigative	Coumarin increases the phosphorylation of Centromere protein V (CENPV).	[30]

13 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Centromere protein V (CENPV).	[19]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Centromere protein V (CENPV).	[20]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Centromere protein V (CENPV).	[21]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Centromere protein V (CENPV).	[22]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Centromere protein V (CENPV).	[23]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Centromere protein V (CENPV).	[24]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Centromere protein V (CENPV).	[25]
Demecolcine	DMCZQGK	Approved	Demecolcine decreases the expression of Centromere protein V (CENPV).	[26]
Clozapine	DMFC71L	Approved	Clozapine increases the expression of Centromere protein V (CENPV).	[27]
Benzatropine	DMF7EXL	Approved	Benzatropine increases the expression of Centromere protein V (CENPV).	[27]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Centromere protein V (CENPV).	[28]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Centromere protein V (CENPV).	[32]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Centromere protein V (CENPV).	[26]

References

• [1] CEBPA-mutated leukemia is sensitive to genetic and pharmacological targeting of the MLL1 complex.Leukemia. 2019 Jul;33(7):1608-1619. doi: 10.1038/s41375-019-0382-3. Epub 2019 Jan 24.
• [2] Requirement of the human T-cell leukemia virus p12 and p30 products for infectivity of human dendritic cells and macaques but not rabbits.Blood. 2010 Nov 11;116(19):3809-17. doi: 10.1182/blood-2010-05-284141. Epub 2010 Jul 20.
• [3] Adherence to Adjuvant Endocrine Therapy in Insured Black and White Breast Cancer Survivors: Exploring Adherence Measures in Patient Data.J Manag Care Spec Pharm. 2019 May;25(5):578-586. doi: 10.18553/jmcp.2019.25.5.578.
• [4] Sex-dependent co-occurrence of hypoxia and -amyloid plaques in hippocampus and entorhinal cortex is reversed by long-term treatment with ubiquinol and ascorbic acid in the 3Tg-AD mouse model of Alzheimer's disease.Mol Cell Neurosci. 2018 Oct;92:67-81. doi: 10.1016/j.mcn.2018.06.005. Epub 2018 Jun 25.
• [5] C9orf72 and UNC13A are shared risk loci for amyotrophic lateral sclerosis and frontotemporal dementia: a genome-wide meta-analysis.Ann Neurol. 2014 Jul;76(1):120-33. doi: 10.1002/ana.24198. Epub 2014 Jun 27.
• [6] Human T-lymphotropic virus type 1 p30 interacts with REGgamma and modulates ATM (ataxia telangiectasia mutated) to promote cell survival.J Biol Chem. 2011 Mar 4;286(9):7661-8. doi: 10.1074/jbc.M110.176354. Epub 2011 Jan 7.
• [7] Revised Equations to Estimate Glomerular Filtration Rate from Serum Creatinine and Cystatin C in China.Kidney Blood Press Res. 2019;44(4):553-564. doi: 10.1159/000500460. Epub 2019 Jun 28.
• [8] FUS-DDIT3 prevents the development of adipocytic precursors in liposarcoma by repressing PPARgamma and C/EBPalpha and activating eIF4E.PLoS One. 2008 Jul 2;3(7):e2569. doi: 10.1371/journal.pone.0002569.
• [9] Type-C RNA virus gene expression in human tissue.J Virol. 1974 Dec;14(6):1584-96. doi: 10.1128/JVI.14.6.1584-1596.1974.
• [10] Interactions between Macrophages and Cyst-Lining Epithelial Cells Promote Kidney Cyst Growth in Pkd1-Deficient Mice.J Am Soc Nephrol. 2018 Sep;29(9):2310-2325. doi: 10.1681/ASN.2018010074. Epub 2018 Jul 24.
• [11] Melatonin delays photoreceptor degeneration in a mouse model of autosomal recessive retinitis pigmentosa.J Pineal Res. 2017 Oct;63(3). doi: 10.1111/jpi.12428. Epub 2017 Jun 20.
• [12] Transcranial Magnetic Stimulation-EEG Biomarkers of Poststroke Upper-Limb Motor Function.J Stroke Cerebrovasc Dis. 2019 Dec;28(12):104452. doi: 10.1016/j.jstrokecerebrovasdis.2019.104452. Epub 2019 Oct 19.
• [13] Orf-I and orf-II-encoded proteins in HTLV-1 infection and persistence.Viruses. 2011 Jun;3(6):861-85. doi: 10.3390/v3060861. Epub 2011 Jun 17.
• [14] Developmental effects of serotonin 1A autoreceptors on anxiety and social behavior.Neuropsychopharmacology. 2014 Jan;39(2):291-302. doi: 10.1038/npp.2013.185. Epub 2013 Aug 2.
• [15] MicroRNA-mediated GABA A-1 receptor subunit down-regulation in adult spinal cord following neonatal cystitis-induced chronic visceral pain in rats.Pain. 2013 Jan;154(1):59-70. doi: 10.1016/j.pain.2012.09.002.
• [16] Tadalafil treatment in mice for preeclampsia with fetal growth restriction has neuro-benefic effects in offspring through modulating prenatal hypoxic conditions.Sci Rep. 2019 Jan 18;9(1):234. doi: 10.1038/s41598-018-36084-x.
• [17] Polymerase chain reaction approaches for the detection of Neospora caninum and Toxoplasma gondii.Int J Parasitol. 1998 Jul;28(7):1053-60. doi: 10.1016/s0020-7519(98)00096-4.
• [18] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [19] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [20] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [21] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [22] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [23] Characterisation of cisplatin-induced transcriptomics responses in primary mouse hepatocytes, HepG2 cells and mouse embryonic stem cells shows conservation of regulating transcription factor networks. Mutagenesis. 2014 Jan;29(1):17-26.
• [24] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [25] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [26] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [27] Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
• [28] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [29] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [30] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [31] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [32] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.