Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSFZ9JD)

DOT Name Leukocyte cell-derived chemotaxin-2 (LECT2)
Synonyms LECT-2; hLECT2
Gene Name LECT2
Related Disease
Adenoma ( )
Amyloidosis ( )
Arteriosclerosis ( )
Atherosclerosis ( )
Colorectal carcinoma ( )
Fatty liver disease ( )
Hyperglycemia ( )
Hyperinsulinemia ( )
Liver failure ( )
Lung cancer ( )
Lung carcinoma ( )
Neoplasm ( )
Nephropathy ( )
Non-alcoholic fatty liver disease ( )
Non-insulin dependent diabetes ( )
Non-small-cell lung cancer ( )
Visceral leishmaniasis ( )
Bacterial infection ( )
Primary systemic amyloidosis ( )
Chronic kidney disease ( )
Lung neoplasm ( )
Rheumatoid arthritis ( )
UniProt ID
LECT2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
5B0H; 7N2I; 8G2V
Pfam ID
PF01551
Sequence
MFSTKALLLAGLISTALAGPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDILC
SAGSTVYAPFTGMIVGQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPIKKGEKL
GTLLPLQKVYPGIQSHVHIENCDSSDPTAYL
Function Has a neutrophil chemotactic activity. Also a positive regulator of chondrocyte proliferation. Does not show metalloendopeptidase activity.
Tissue Specificity Highly expressed in adult and fetal liver and weakly in testis. Not expressed in bone marrow.

Molecular Interaction Atlas (MIA) of This DOT

22 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Adenoma DIS78ZEV Strong Biomarker [1]
Amyloidosis DISHTAI2 Strong Biomarker [2]
Arteriosclerosis DISK5QGC Strong Biomarker [3]
Atherosclerosis DISMN9J3 Strong Biomarker [3]
Colorectal carcinoma DIS5PYL0 Strong Biomarker [1]
Fatty liver disease DIS485QZ Strong Altered Expression [4]
Hyperglycemia DIS0BZB5 Strong Biomarker [5]
Hyperinsulinemia DISIDWT6 Strong Genetic Variation [6]
Liver failure DISLGEL6 Strong Altered Expression [7]
Lung cancer DISCM4YA Strong Biomarker [8]
Lung carcinoma DISTR26C Strong Biomarker [8]
Neoplasm DISZKGEW Strong Biomarker [9]
Nephropathy DISXWP4P Strong Biomarker [10]
Non-alcoholic fatty liver disease DISDG1NL Strong Biomarker [3]
Non-insulin dependent diabetes DISK1O5Z Strong Altered Expression [11]
Non-small-cell lung cancer DIS5Y6R9 Strong Biomarker [8]
Visceral leishmaniasis DISTKEYK Strong Genetic Variation [12]
Bacterial infection DIS5QJ9S moderate Biomarker [13]
Primary systemic amyloidosis DISIALGI moderate Biomarker [14]
Chronic kidney disease DISW82R7 Limited Biomarker [15]
Lung neoplasm DISVARNB Limited Therapeutic [8]
Rheumatoid arthritis DISTSB4J Limited Genetic Variation [16]
------------------------------------------------------------------------------------
⏷ Show the Full List of 22 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Leukocyte cell-derived chemotaxin-2 (LECT2). [17]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Leukocyte cell-derived chemotaxin-2 (LECT2). [18]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Leukocyte cell-derived chemotaxin-2 (LECT2). [19]
------------------------------------------------------------------------------------

References

1 Lect2 deficiency is characterised by altered cytokine levels and promotion of intestinal tumourigenesis.Oncotarget. 2018 Nov 23;9(92):36430-36443. doi: 10.18632/oncotarget.26335. eCollection 2018 Nov 23.
2 LECT2 Amyloidosis in Kidney Transplantation: A Report of 5 Cases.Am J Kidney Dis. 2019 Oct;74(4):563-566. doi: 10.1053/j.ajkd.2018.10.016. Epub 2019 May 30.
3 Association of leukocyte cell-derived chemotaxin 2 (LECT2) with NAFLD, metabolic syndrome, and atherosclerosis.PLoS One. 2017 Apr 4;12(4):e0174717. doi: 10.1371/journal.pone.0174717. eCollection 2017.
4 A dipeptidyl peptidase-IV inhibitor improves hepatic steatosis and insulin resistance by AMPK-dependent and JNK-dependent inhibition of LECT2 expression.Biochem Pharmacol. 2015 Nov 1;98(1):157-66. doi: 10.1016/j.bcp.2015.08.098. Epub 2015 Aug 20.
5 Circulating Concentrations of Insulin Resistance-Associated Hepatokines, Selenoprotein P and Leukocyte Cell-Derived Chemotaxin 2, during an Oral Glucose Tolerance Test in Humans.Biol Pharm Bull. 2019 Mar 1;42(3):373-378. doi: 10.1248/bpb.b18-00549. Epub 2018 Dec 28.
6 LECT2 functions as a hepatokine that links obesity to skeletal muscle insulin resistance.Diabetes. 2014 May;63(5):1649-64. doi: 10.2337/db13-0728. Epub 2014 Jan 29.
7 Serum LECT2 level as a prognostic indicator in acute liver failure.Transplant Proc. 2004 Oct;36(8):2359-61. doi: 10.1016/j.transproceed.2004.07.007.
8 Leukocyte Cell-Derived Chemotaxin 2 Retards Non-Small Cell Lung Cancer Progression Through Antagonizing MET and EGFR Activities.Cell Physiol Biochem. 2018;51(1):337-355. doi: 10.1159/000495233. Epub 2018 Nov 19.
9 Lect2 Controls Inflammatory Monocytes to Constrain the Growth and Progression of Hepatocellular Carcinoma.Hepatology. 2019 Jan;69(1):160-178. doi: 10.1002/hep.30140. Epub 2018 Dec 22.
10 De novo leukocyte chemotactic factor 2 amyloidosis in a pediatric renal allograft, 15years post-transplant.Pediatr Transplant. 2019 May;23(3):e13371. doi: 10.1111/petr.13371. Epub 2019 Feb 3.
11 Circulating LECT2 levels in newly diagnosed type 2 diabetes mellitus and their association with metabolic parameters: An observational study.Medicine (Baltimore). 2018 Apr;97(15):e0354. doi: 10.1097/MD.0000000000010354.
12 Genes at human chromosome 5q31.1 regulate delayed-type hypersensitivity responses associated with Leishmania chagasi infection.Genes Immun. 2007 Oct;8(7):539-51. doi: 10.1038/sj.gene.6364422. Epub 2007 Aug 23.
13 Characterization of the LECT2 gene and its protective effects against microbial infection via large lymphocytes in Lampetra japonica.Dev Comp Immunol. 2018 Feb;79:75-85. doi: 10.1016/j.dci.2017.09.018. Epub 2017 Oct 19.
14 Mixed leukocyte cell-derived chemotaxin 2 and amyloid A renal amyloidosis in a Kazakh-German patient.Clin Kidney J. 2017 Apr;10(2):266-268. doi: 10.1093/ckj/sfw147. Epub 2017 Feb 3.
15 Prevalence and organ distribution of leukocyte chemotactic factor 2 amyloidosis (ALECT2) among decedents in New Mexico.Amyloid. 2016 Jun;23(2):119-23. doi: 10.3109/13506129.2016.1145110. Epub 2016 Feb 25.
16 Association of chondromodulin-II Val58Ile polymorphism with radiographic joint destruction in rheumatoid arthritis.J Rheumatol. 2005 Sep;32(9):1654-61.
17 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
18 Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
19 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.