Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTV0O3JN)

• DOT Name: Protein MCM10 homolog (MCM10)
• Synonyms: HsMCM10
• Gene Name: MCM10
• Related Disease:
  Advanced cancer
  Breast cancer
  Breast carcinoma
  Cervical cancer
  Cervical carcinoma
  Esophageal squamous cell carcinoma
  Fanconi anemia complementation group A
  Fanconi's anemia
  Hepatocellular carcinoma
  Lung adenocarcinoma
  Lung cancer
  Lung carcinoma
  Medulloblastoma
  Megalencephaly-capillary malformation-polymicrogyria syndrome
  Neoplasm
  Prostate cancer
  Prostate carcinoma
  Transitional cell carcinoma
  Urothelial carcinoma
  Immunodeficiency 80 with or without congenital cardiomyopathy
• UniProt ID: MCM10_HUMAN
• Pfam ID: PF09332 ; PF09329
• Sequence:
  MDEEEDNLSLLTALLEENESALDCNSEENNFLTRENGEPDAFDELFDADGDGESYTEEAD
  DGETGETRDEKENLATLFGDMEDLTDEEEVPASQSTENRVLPAPAPRREKTNEELQEELR
  NLQEQMKALQEQLKVTTIKQTASPARLQKSPVEKSPRPPLKERRVQRIQESTCFSAELDV
  PALPRTKRVARTPKASPPDPKSSSSRMTSAPSQPLQTISRNKPSGITRGQIVGTPGSSGE
  TTQPICVEAFSGLRLRRPRVSSTEMNKKMTGRKLIRLSQIKEKMAREKLEEIDWVTFGVI
  LKKVTPQSVNSGKTFSIWKLNDLRDLTQCVSLFLFGEVHKALWKTEQGTVVGILNANPMK
  PKDGSEEVCLSIDHPQKVLIMGEALDLGTCKAKKKNGEPCTQTVNLRDCEYCQYHVQAQY
  KKLSAKRADLQSTFSGGRIPKKFARRGTSLKERLCQDGFYYGGVSSASYAASIAAAVAPK
  KKIQTTLSNLVVKGTNLIIQETRQKLGIPQKSLSCSEEFKELMDLPTCGARNLKQHLAKA
  TASGIMGSPKPAIKSISASALLKQQKQRMLEMRRRKSEEIQKRFLQSSSEVESPAVPSSS
  RQPPAQPPRTGSEFPRLEGAPATMTPKLGRGVLEGDDVLFYDESPPPRPKLSALAEAKKL
  AAITKLRAKGQVLTKTNPNSIKKKQKDPQDILEVKERVEKNTMFSSQAEDELEPARKKRR
  EQLAYLESEEFQKILKAKSKHTGILKEAEAEMQERYFEPLVKKEQMEEKMRNIREVKCRV
  VTCKTCAYTHFKLLETCVSEQHEYHWHDGVKRFFKCPCGNRSISLDRLPNKHCSNCGLYK
  WERDGMLKEKTGPKIGGETLLPRGEEHAKFLNSLK
• Function: Acts as a replication initiation factor that brings together the MCM2-7 helicase and the DNA polymerase alpha/primase complex in order to initiate DNA replication. Additionally, plays a role in preventing DNA damage during replication. Key effector of the RBBP6 and ZBTB38-mediated regulation of DNA-replication and common fragile sites stability; acts as a direct target of transcriptional repression by ZBTB38.
• Reactome Pathway:
  Activation of the pre-replicative complex (R-HSA-68962)
  Activation of ATR in response to replication stress (R-HSA-176187)

Molecular Interaction Atlas (MIA) of This DOT

20 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[1]
Breast cancer	DIS7DPX1	Strong	Biomarker	[2]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[2]
Cervical cancer	DISFSHPF	Strong	Biomarker	[3]
Cervical carcinoma	DIST4S00	Strong	Biomarker	[3]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Altered Expression	[3]
Fanconi anemia complementation group A	DIS8PZLI	Strong	Biomarker	[4]
Fanconi's anemia	DISGW6Q8	Strong	Biomarker	[4]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[5]
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[6]
Lung cancer	DISCM4YA	Strong	Biomarker	[1]
Lung carcinoma	DISTR26C	Strong	Biomarker	[1]
Medulloblastoma	DISZD2ZL	Strong	Altered Expression	[7]
Megalencephaly-capillary malformation-polymicrogyria syndrome	DISAHLVO	Strong	Biomarker	[8]
Neoplasm	DISZKGEW	Strong	Biomarker	[9]
Prostate cancer	DISF190Y	Strong	Altered Expression	[10]
Prostate carcinoma	DISMJPLE	Strong	Altered Expression	[10]
Transitional cell carcinoma	DISWVVDR	Strong	Biomarker	[3]
Urothelial carcinoma	DISRTNTN	Strong	Biomarker	[3]
Immunodeficiency 80 with or without congenital cardiomyopathy	DISFXSUU	Limited	Autosomal recessive	[11]

34 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of Protein MCM10 homolog (MCM10).	[12]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Protein MCM10 homolog (MCM10).	[13]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Protein MCM10 homolog (MCM10).	[14]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Protein MCM10 homolog (MCM10).	[15]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Protein MCM10 homolog (MCM10).	[16]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Protein MCM10 homolog (MCM10).	[17]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Protein MCM10 homolog (MCM10).	[18]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Protein MCM10 homolog (MCM10).	[19]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Protein MCM10 homolog (MCM10).	[20]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Protein MCM10 homolog (MCM10).	[21]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Protein MCM10 homolog (MCM10).	[22]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Protein MCM10 homolog (MCM10).	[22]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Protein MCM10 homolog (MCM10).	[23]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil affects the expression of Protein MCM10 homolog (MCM10).	[24]
Niclosamide	DMJAGXQ	Approved	Niclosamide decreases the expression of Protein MCM10 homolog (MCM10).	[25]
Cannabidiol	DM0659E	Approved	Cannabidiol decreases the expression of Protein MCM10 homolog (MCM10).	[26]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of Protein MCM10 homolog (MCM10).	[27]
Etoposide	DMNH3PG	Approved	Etoposide decreases the expression of Protein MCM10 homolog (MCM10).	[18]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of Protein MCM10 homolog (MCM10).	[28]
Mitomycin	DMH0ZJE	Approved	Mitomycin decreases the expression of Protein MCM10 homolog (MCM10).	[18]
Lucanthone	DMZLBUO	Approved	Lucanthone decreases the expression of Protein MCM10 homolog (MCM10).	[29]
Methamphetamine	DMPM4SK	Approved	Methamphetamine decreases the expression of Protein MCM10 homolog (MCM10).	[30]
Palbociclib	DMD7L94	Approved	Palbociclib decreases the expression of Protein MCM10 homolog (MCM10).	[31]
Colchicine	DM2POTE	Approved	Colchicine decreases the expression of Protein MCM10 homolog (MCM10).	[18]
Adenine	DMZLHKJ	Approved	Adenine decreases the expression of Protein MCM10 homolog (MCM10).	[18]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Protein MCM10 homolog (MCM10).	[32]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Protein MCM10 homolog (MCM10).	[19]
GSK2110183	DMZHB37	Phase 2	GSK2110183 decreases the expression of Protein MCM10 homolog (MCM10).	[33]
PEITC	DMOMN31	Phase 2	PEITC decreases the expression of Protein MCM10 homolog (MCM10).	[34]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Protein MCM10 homolog (MCM10).	[36]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Protein MCM10 homolog (MCM10).	[38]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Protein MCM10 homolog (MCM10).	[40]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Protein MCM10 homolog (MCM10).	[41]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Protein MCM10 homolog (MCM10).	[42]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Protein MCM10 homolog (MCM10).	[35]
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Protein MCM10 homolog (MCM10).	[37]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Protein MCM10 homolog (MCM10).	[39]
Coumarin	DM0N8ZM	Investigative	Coumarin increases the phosphorylation of Protein MCM10 homolog (MCM10).	[39]

References

• [1] Minichromosome maintenance protein 10 as a marker for proliferation and prognosis in lung cancer.Int J Oncol. 2019 Dec;55(6):1349-1360. doi: 10.3892/ijo.2019.4899. Epub 2019 Oct 14.
• [2] MCM10 facilitates the invaded/migrated potentials of breast cancer cells via Wnt/-catenin signaling and is positively interlinked with poor prognosis in breast carcinoma.J Biochem Mol Toxicol. 2019 Jul;33(7):e22330. doi: 10.1002/jbt.22330. Epub 2019 Apr 16.
• [3] Ablation of MCM10 using CRISPR/Cas9 restrains the growth and migration of esophageal squamous cell carcinoma cells through inhibition of Akt signaling.Onco Targets Ther. 2018 Jun 6;11:3323-3333. doi: 10.2147/OTT.S157025. eCollection 2018.
• [4] Tumor treating fields cause replication stress and interfere with DNA replication fork maintenance: Implications for cancer therapy.Transl Res. 2020 Mar;217:33-46. doi: 10.1016/j.trsl.2019.10.003. Epub 2019 Oct 21.
• [5] MCM family in HCC: MCM6 indicates adverse tumor features and poor outcomes and promotes S/G2 cell cycle progression.BMC Cancer. 2018 Feb 20;18(1):200. doi: 10.1186/s12885-018-4056-8.
• [6] Prognostic significance of minichromosome maintenance mRNA expression in human lung adenocarcinoma.Oncol Rep. 2019 Dec;42(6):2279-2292. doi: 10.3892/or.2019.7330. Epub 2019 Sep 23.
• [7] Overexpression of minichromosome maintenance protein 10 in medulloblastoma and its clinical implications.Pediatr Blood Cancer. 2017 Dec;64(12). doi: 10.1002/pbc.26670. Epub 2017 Jun 9.
• [8] Fine-tuning of the replisome: Mcm10 regulates fork progression and regression.Cell Cycle. 2019 May;18(10):1047-1055. doi: 10.1080/15384101.2019.1609833. Epub 2019 May 5.
• [9] Co-expression network analysis identified candidate biomarkers in association with progression and prognosis of breast cancer.J Cancer Res Clin Oncol. 2019 Sep;145(9):2383-2396. doi: 10.1007/s00432-019-02974-4. Epub 2019 Jul 6.
• [10] Overexpression of MCM10 promotes cell proliferation and predicts poor prognosis in prostate cancer.Prostate. 2018 Dec;78(16):1299-1310. doi: 10.1002/pros.23703. Epub 2018 Aug 10.
• [11] Human NK cell deficiency as a result of biallelic mutations in MCM10. J Clin Invest. 2020 Oct 1;130(10):5272-5286. doi: 10.1172/JCI134966.
• [12] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [13] Inter-laboratory comparison of human renal proximal tubule (HK-2) transcriptome alterations due to Cyclosporine A exposure and medium exhaustion. Toxicol In Vitro. 2009 Apr;23(3):486-99.
• [14] Effect of retinoic acid on gene expression in human conjunctival epithelium: secretory phospholipase A2 mediates retinoic acid induction of MUC16. Invest Ophthalmol Vis Sci. 2005 Nov;46(11):4050-61.
• [15] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [16] RNA sequence analysis of inducible pluripotent stem cell-derived cardiomyocytes reveals altered expression of DNA damage and cell cycle genes in response to doxorubicin. Toxicol Appl Pharmacol. 2018 Oct 1;356:44-53.
• [17] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [18] Utilization of CDKN1A/p21 gene for class discrimination of DNA damage-induced clastogenicity. Toxicology. 2014 Jan 6;315:8-16. doi: 10.1016/j.tox.2013.10.009. Epub 2013 Nov 6.
• [19] Convergent transcriptional profiles induced by endogenous estrogen and distinct xenoestrogens in breast cancer cells. Carcinogenesis. 2006 Aug;27(8):1567-78.
• [20] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [21] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [22] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [23] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [24] Multi-level gene expression profiles affected by thymidylate synthase and 5-fluorouracil in colon cancer. BMC Genomics. 2006 Apr 3;7:68. doi: 10.1186/1471-2164-7-68.
• [25] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [26] Cannabidiol-induced transcriptomic changes and cellular senescence in human Sertoli cells. Toxicol Sci. 2023 Feb 17;191(2):227-238. doi: 10.1093/toxsci/kfac131.
• [27] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [28] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [29] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [30] Methamphetamine alters the normal progression by inducing cell cycle arrest in astrocytes. PLoS One. 2014 Oct 7;9(10):e109603.
• [31] Cdk4/6 inhibition induces epithelial-mesenchymal transition and enhances invasiveness in pancreatic cancer cells. Mol Cancer Ther. 2012 Oct;11(10):2138-48. doi: 10.1158/1535-7163.MCT-12-0562. Epub 2012 Aug 6.
• [32] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [33] Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
• [34] Phenethyl isothiocyanate alters the gene expression and the levels of protein associated with cell cycle regulation in human glioblastoma GBM 8401 cells. Environ Toxicol. 2017 Jan;32(1):176-187.
• [35] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [36] BET bromodomain inhibition of MYC-amplified medulloblastoma. Clin Cancer Res. 2014 Feb 15;20(4):912-25.
• [37] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [38] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [39] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [40] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [41] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [42] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.