Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXNR2WQ)

DOT Name Estrogen receptor beta (ESR2)
Synonyms ER-beta; Nuclear receptor subfamily 3 group A member 2
Gene Name ESR2
Related Disease
Obsolete male infertility with azoospermia or oligozoospermia due to single gene mutation ( )
Familial medullary thyroid carcinoma ( )
Ovarian dysgenesis 8 ( )
UniProt ID
ESR2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1L2J ; 1NDE ; 1QKM ; 1U3Q ; 1U3R ; 1U3S ; 1U9E ; 1X76 ; 1X78 ; 1X7B ; 1X7J ; 1YY4 ; 1YYE ; 1ZAF ; 2FSZ ; 2GIU ; 2I0G ; 2JJ3 ; 2NV7 ; 2QTU ; 2YJD ; 2YLY ; 2Z4B ; 3OLL ; 3OLS ; 3OMO ; 3OMP ; 3OMQ ; 4J24 ; 4J26 ; 4ZI1 ; 5TOA ; 7XVY ; 7XVZ ; 7XWP ; 7XWQ ; 7XWR
Pfam ID
PF12497 ; PF00104 ; PF00105
Sequence
MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPS
NVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVN
RETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGH
NDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLH
CAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTK
LADKELVHMISWAKKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDL
VLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYPLVTATQDA
DSSRKLAHLLNAVTDALVWVIAKSGISSQQQSMRLANLLMLLSHVRHASNKGMEHLLNMK
CKNVVPVYDLLLEMLNAHVLRGCKSSITGSECSPAEDSKSKEGSQNPQSQ
Function
Nuclear hormone receptor. Binds estrogens with an affinity similar to that of ESR1/ER-alpha, and activates expression of reporter genes containing estrogen response elements (ERE) in an estrogen-dependent manner ; [Isoform 2]: Lacks ligand binding ability and has no or only very low ERE binding activity resulting in the loss of ligand-dependent transactivation ability.
Tissue Specificity
.Expressed in testis and ovary, and at a lower level in heart, brain, placenta, liver, skeletal muscle, spleen, thymus, prostate, colon, bone marrow, mammary gland and uterus. Also found in uterine bone, breast, and ovarian tumor cell lines, but not in colon and liver tumors.; [Isoform 2]: Expressed in spleen, thymus, testis and ovary and at a lower level in skeletal muscle, prostate, colon, small intestine, leukocytes, bone marrow, mammary gland and uterus.; [Isoform 4]: Expressed in the testis.; [Isoform 5]: Expressed in testis, and at a lower level in spleen, thymus, ovary, mammary gland and uterus.; [Isoform 6]: Expressed in testis, placenta, skeletal muscle, spleen and leukocytes, and at a lower level in heart, lung, liver, kidney, pancreas, thymus, prostate, colon, small intestine, bone marrow, mammary gland and uterus. Not expressed in brain.
KEGG Pathway
Endocrine resistance (hsa01522 )
Estrogen sig.ling pathway (hsa04915 )
Prolactin sig.ling pathway (hsa04917 )
GnRH secretion (hsa04929 )
Pathways in cancer (hsa05200 )
Chemical carcinogenesis - receptor activation (hsa05207 )
Breast cancer (hsa05224 )
Reactome Pathway
Constitutive Signaling by Aberrant PI3K in Cancer (R-HSA-2219530 )
Nuclear Receptor transcription pathway (R-HSA-383280 )
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling (R-HSA-6811558 )
ESR-mediated signaling (R-HSA-8939211 )
Extra-nuclear estrogen signaling (R-HSA-9009391 )
PIP3 activates AKT signaling (R-HSA-1257604 )

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Obsolete male infertility with azoospermia or oligozoospermia due to single gene mutation DIS56JR8 Moderate Autosomal recessive [1]
Familial medullary thyroid carcinoma DIS01PWX Supportive Autosomal dominant [2]
Ovarian dysgenesis 8 DIS7FO4V Limited Autosomal dominant [3]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 3 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Etoposide DMNH3PG Approved Estrogen receptor beta (ESR2) increases the response to substance of Etoposide. [55]
Isoflavone DM7U58J Phase 4 Estrogen receptor beta (ESR2) affects the response to substance of Isoflavone. [56]
9-phenanthrol DMJFBQ1 Investigative Estrogen receptor beta (ESR2) affects the binding of 9-phenanthrol. [57]
------------------------------------------------------------------------------------
50 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the activity of Estrogen receptor beta (ESR2). [4]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Estrogen receptor beta (ESR2). [5]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Estrogen receptor beta (ESR2). [5]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Estrogen receptor beta (ESR2). [6]
Arsenic DMTL2Y1 Approved Arsenic increases the expression of Estrogen receptor beta (ESR2). [7]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Estrogen receptor beta (ESR2). [8]
Decitabine DMQL8XJ Approved Decitabine decreases the expression of Estrogen receptor beta (ESR2). [10]
Progesterone DMUY35B Approved Progesterone increases the expression of Estrogen receptor beta (ESR2). [11]
Fulvestrant DM0YZC6 Approved Fulvestrant increases the expression of Estrogen receptor beta (ESR2). [12]
Dexamethasone DMMWZET Approved Dexamethasone increases the expression of Estrogen receptor beta (ESR2). [13]
Diethylstilbestrol DMN3UXQ Approved Diethylstilbestrol increases the activity of Estrogen receptor beta (ESR2). [14]
Paclitaxel DMLB81S Approved Paclitaxel decreases the expression of Estrogen receptor beta (ESR2). [5]
Ethinyl estradiol DMODJ40 Approved Ethinyl estradiol increases the activity of Estrogen receptor beta (ESR2). [15]
Lindane DMB8CNL Approved Lindane increases the activity of Estrogen receptor beta (ESR2). [16]
Gefitinib DM15F0X Approved Gefitinib increases the expression of Estrogen receptor beta (ESR2). [17]
Adenosine DMM2NSK Approved Adenosine increases the expression of Estrogen receptor beta (ESR2). [19]
Mitotane DMU1GX0 Approved Mitotane increases the activity of Estrogen receptor beta (ESR2). [21]
Flutamide DMK0O7U Approved Flutamide increases the expression of Estrogen receptor beta (ESR2). [22]
Tibolone DM78XFG Approved Tibolone increases the activity of Estrogen receptor beta (ESR2). [23]
Dihydrotestosterone DM3S8XC Phase 4 Dihydrotestosterone decreases the expression of Estrogen receptor beta (ESR2). [24]
Resveratrol DM3RWXL Phase 3 Resveratrol increases the expression of Estrogen receptor beta (ESR2). [25]
Epigallocatechin gallate DMCGWBJ Phase 3 Epigallocatechin gallate decreases the expression of Estrogen receptor beta (ESR2). [26]
Rigosertib DMOSTXF Phase 3 Rigosertib increases the expression of Estrogen receptor beta (ESR2). [27]
Guaiacol DMN4E7T Phase 3 Guaiacol decreases the expression of Estrogen receptor beta (ESR2). [26]
Afimoxifene DMFORDT Phase 2 Afimoxifene increases the activity of Estrogen receptor beta (ESR2). [28]
phorbol 12-myristate 13-acetate DMJWD62 Phase 2 phorbol 12-myristate 13-acetate increases the expression of Estrogen receptor beta (ESR2). [29]
Puerarin DMJIMXH Phase 2 Puerarin decreases the expression of Estrogen receptor beta (ESR2). [26]
Icaritin DMGHQ37 Phase 2 Icaritin increases the activity of Estrogen receptor beta (ESR2). [30]
GSK618334 DMJPXZ4 Phase 1 GSK618334 decreases the expression of Estrogen receptor beta (ESR2). [32]
Flavonoid derivative 1 DMCQP0B Patented Flavonoid derivative 1 increases the activity of Estrogen receptor beta (ESR2). [34]
MG-132 DMKA2YS Preclinical MG-132 increases the expression of Estrogen receptor beta (ESR2). [35]
Dioscin DM5H2W9 Preclinical Dioscin increases the expression of Estrogen receptor beta (ESR2). [36]
EMODIN DMAEDQG Terminated EMODIN increases the activity of Estrogen receptor beta (ESR2). [14]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Estrogen receptor beta (ESR2). [38]
methyl p-hydroxybenzoate DMO58UW Investigative methyl p-hydroxybenzoate increases the expression of Estrogen receptor beta (ESR2). [39]
Glyphosate DM0AFY7 Investigative Glyphosate increases the expression of Estrogen receptor beta (ESR2). [40]
D-glucose DMMG2TO Investigative D-glucose decreases the expression of Estrogen receptor beta (ESR2). [41]
Forskolin DM6ITNG Investigative Forskolin decreases the expression of Estrogen receptor beta (ESR2). [42]
Chlorpyrifos DMKPUI6 Investigative Chlorpyrifos decreases the expression of Estrogen receptor beta (ESR2). [43]
Kaempferol DMHEMUB Investigative Kaempferol increases the activity of Estrogen receptor beta (ESR2). [45]
Apigenin DMI3491 Investigative Apigenin increases the activity of Estrogen receptor beta (ESR2). [45]
Apicidin DM83WVF Investigative Apicidin decreases the expression of Estrogen receptor beta (ESR2). [46]
Piceatannol DMYOP45 Investigative Piceatannol increases the activity of Estrogen receptor beta (ESR2). [47]
Tetramethylbutylphenol DMW9CH2 Investigative Tetramethylbutylphenol increases the expression of Estrogen receptor beta (ESR2). [48]
Hydroxyestradiol DMJXQME Investigative Hydroxyestradiol decreases the expression of Estrogen receptor beta (ESR2). [49]
2-hydroxy-17beta-estradiol DMM9Z0B Investigative 2-hydroxy-17beta-estradiol decreases the expression of Estrogen receptor beta (ESR2). [49]
chlordane DMMHU8G Investigative chlordane increases the activity of Estrogen receptor beta (ESR2). [16]
propylpyrazoletriol DMTCP8K Investigative propylpyrazoletriol increases the expression of Estrogen receptor beta (ESR2). [51]
Aniline DMLCAR9 Investigative Aniline increases the expression of Estrogen receptor beta (ESR2). [52]
LIQUIRTIGENIN DM6YSG3 Investigative LIQUIRTIGENIN increases the activity of Estrogen receptor beta (ESR2). [53]
------------------------------------------------------------------------------------
⏷ Show the Full List of 50 Drug(s)
18 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT
Drug Name Drug ID Highest Status Interaction REF
Testosterone DM7HUNW Approved Testosterone affects the binding of Estrogen receptor beta (ESR2). [9]
Estrone DM5T6US Approved Estrone affects the binding of Estrogen receptor beta (ESR2). [18]
Mestranol DMG3F94 Approved Mestranol affects the binding of Estrogen receptor beta (ESR2). [20]
Estriol DMOEM2I Approved Estriol affects the binding of Estrogen receptor beta (ESR2). [18]
Eugenol DM7US1H Patented Eugenol affects the binding of Estrogen receptor beta (ESR2). [33]
geraniol DMS3CBD Investigative geraniol affects the binding of Estrogen receptor beta (ESR2). [33]
Dibutyl phthalate DMEDGKO Investigative Dibutyl phthalate affects the binding of Estrogen receptor beta (ESR2). [44]
Chrysin DM7V2LG Investigative Chrysin affects the binding of Estrogen receptor beta (ESR2). [20]
biochanin A DM0HPWY Investigative biochanin A affects the binding of Estrogen receptor beta (ESR2). [20]
N-nonylphenol DMH3OUX Investigative N-nonylphenol affects the binding of Estrogen receptor beta (ESR2). [18]
Flavone DMEQH6J Investigative Flavone affects the binding of Estrogen receptor beta (ESR2). [20]
Formononetin DM7WFZ8 Investigative Formononetin affects the binding of Estrogen receptor beta (ESR2). [20]
ISORHAMNETIN DMQ4Z6E Investigative ISORHAMNETIN affects the binding of Estrogen receptor beta (ESR2). [50]
Phloretin DMYA50U Investigative Phloretin affects the binding of Estrogen receptor beta (ESR2). [20]
citral DM53ZGY Investigative citral affects the binding of Estrogen receptor beta (ESR2). [33]
Phthalic Acid DMF9T64 Investigative Phthalic Acid increases the degradation of Estrogen receptor beta (ESR2). [35]
trichloroethanol DMNALMF Investigative trichloroethanol affects the binding of Estrogen receptor beta (ESR2). [20]
WAY-169916 DM94KWA Investigative WAY-169916 affects the binding of Estrogen receptor beta (ESR2). [54]
------------------------------------------------------------------------------------
⏷ Show the Full List of 18 Drug(s)
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Estrogen receptor beta (ESR2). [31]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Estrogen receptor beta (ESR2). [37]
------------------------------------------------------------------------------------

References

1 A genomics approach to male infertility. Genet Med. 2020 Dec;22(12):1967-1975. doi: 10.1038/s41436-020-0916-0. Epub 2020 Jul 28.
2 Germline ESR2 mutation predisposes to medullary thyroid carcinoma and causes up-regulation of RET expression. Hum Mol Genet. 2016 May 1;25(9):1836-45. doi: 10.1093/hmg/ddw057. Epub 2016 Mar 3.
3 Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
4 Valproic acid and its derivatives enhanced estrogenic activity but not androgenic activity in a structure dependent manner. Reprod Toxicol. 2013 Dec;42:49-57. doi: 10.1016/j.reprotox.2013.07.019. Epub 2013 Jul 26.
5 Treatment with anticancer agents induces dysregulation of specific Wnt signaling pathways in human ovarian luteinized granulosa cells in vitro. Toxicol Sci. 2013 Nov;136(1):183-92. doi: 10.1093/toxsci/kft175. Epub 2013 Aug 16.
6 Effects of the pesticides prochloraz and methiocarb on human estrogen receptor alpha and beta mRNA levels analyzed by on-line RT-PCR. Toxicol In Vitro. 2004 Aug;18(4):427-33. doi: 10.1016/j.tiv.2003.12.008.
7 [Expression and significance of ERalpha mRNA of residents exposed to arsenic via drinking water]. Wei Sheng Yan Jiu. 2014 May;43(3):472-6.
8 Quercetin exerts bidirectional regulation effects on the efficacy of tamoxifen in estrogen receptor-positive breast cancer therapy: An in vitro study. Environ Toxicol. 2020 Nov;35(11):1179-1193. doi: 10.1002/tox.22983. Epub 2020 Jun 12.
9 Comparison of relative binding affinities to fish and mammalian estrogen receptors: the regulatory implications. Toxicol Lett. 2010 Feb 15;192(3):298-315. doi: 10.1016/j.toxlet.2009.11.004. Epub 2009 Nov 12.
10 Changes in gene expression and assessment of DNA methylation in primary human hepatocytes and HepG2 cells exposed to the environmental contaminants-Hexabromocyclododecane and 17-beta oestradiol. Toxicology. 2009 Feb 27;256(3):143-51. doi: 10.1016/j.tox.2008.10.017. Epub 2008 Nov 5.
11 Regulation of estrogen receptor (ER) levels in MCF-7 cells by progesterone metabolites. J Steroid Biochem Mol Biol. 2007 Nov-Dec;107(3-5):172-9. doi: 10.1016/j.jsbmb.2007.05.030. Epub 2007 Jun 22.
12 Arsenite and cadmium promote the development of mammary tumors. Carcinogenesis. 2020 Jul 14;41(7):1005-1014. doi: 10.1093/carcin/bgz176.
13 The effects of bisphenol A and bisphenol S on adipokine expression and glucose metabolism in human adipose tissue. Toxicology. 2020 Dec 1;445:152600. doi: 10.1016/j.tox.2020.152600. Epub 2020 Sep 22.
14 Validation of a new yeast-based reporter assay consisting of human estrogen receptors alpha/beta and coactivator SRC-1: application for detection of estrogenic activity in environmental samples. Environ Toxicol. 2009 Oct;24(5):513-21. doi: 10.1002/tox.20473.
15 Comparison of in vivo and in vitro reporter gene assays for short-term screening of estrogenic activity. Environ Sci Technol. 2002 Oct 15;36(20):4410-5. doi: 10.1021/es010323a.
16 Screening for estrogen and androgen receptor activities in 200 pesticides by in vitro reporter gene assays using Chinese hamster ovary cells. Environ Health Perspect. 2004 Apr;112(5):524-31. doi: 10.1289/ehp.6649.
17 Combined tamoxifen and gefitinib in non-small cell lung cancer shows antiproliferative effects. Biomed Pharmacother. 2010 Feb;64(2):88-92. doi: 10.1016/j.biopha.2009.06.010. Epub 2009 Oct 23.
18 Comparison of an array of in vitro assays for the assessment of the estrogenic potential of natural and synthetic estrogens, phytoestrogens and xenoestrogens. Toxicology. 2001 Sep 14;166(1-2):79-89. doi: 10.1016/s0300-483x(01)00437-1.
19 Estrogenic Effects of the Extracts from the Chinese Yam (Dioscorea opposite Thunb.) and Its Effective Compounds in Vitro and in Vivo. Molecules. 2018 Jan 23;23(2):11. doi: 10.3390/molecules23020011.
20 Relationship between estrogen receptor-binding and estrogenic activities of environmental estrogens and suppression by flavonoids. Biosci Biotechnol Biochem. 2002 Jul;66(7):1479-87. doi: 10.1271/bbb.66.1479.
21 Development of a recombinant human ovarian (BG1) cell line containing estrogen receptor and for improved detection of estrogenic/antiestrogenic chemicals. Environ Toxicol Chem. 2016 Jan;35(1):91-100. doi: 10.1002/etc.3146. Epub 2015 Dec 9.
22 Arylpiperazines for management of benign prostatic hyperplasia: design, synthesis, quantitative structure-activity relationships, and pharmacokinetic studies. J Med Chem. 2011 Jan 13;54(1):302-11. doi: 10.1021/jm101163m. Epub 2010 Dec 3.
23 Estrogenic effects of natural and synthetic compounds including tibolone assessed in Saccharomyces cerevisiae expressing the human estrogen alpha and beta receptors. FASEB J. 2006 Jul;20(9):1552-4. doi: 10.1096/fj.05-5413fje. Epub 2006 May 23.
24 Unique bisphenol A transcriptome in prostate cancer: novel effects on ERbeta expression that correspond to androgen receptor mutation status. Environ Health Perspect. 2007 Nov;115(11):1646-53. doi: 10.1289/ehp.10283.
25 4-(E)-{(p-tolylimino)-methylbenzene-1,2-diol}, 1 a novel resveratrol analog, differentially regulates estrogen receptors and in breast cancer cells. Toxicol Appl Pharmacol. 2016 Jun 15;301:1-13. doi: 10.1016/j.taap.2016.03.003. Epub 2016 Mar 9.
26 Examining the genomic influence of skin antioxidants in vitro. Mediators Inflamm. 2010;2010.
27 ON 01910.Na is selectively cytotoxic for chronic lymphocytic leukemia cells through a dual mechanism of action involving PI3K/AKT inhibition and induction of oxidative stress. Clin Cancer Res. 2012 Apr 1;18(7):1979-91. doi: 10.1158/1078-0432.CCR-11-2113. Epub 2012 Feb 20.
28 Characterizing properties of non-estrogenic substituted bisphenol analogs using high throughput microscopy and image analysis. PLoS One. 2017 Jul 13;12(7):e0180141. doi: 10.1371/journal.pone.0180141. eCollection 2017.
29 Modulation of gene expression by Polyalthia longifolia in postmenopausal women with coronary artery disease: an in vitro study. J Cardiovasc Transl Res. 2010 Oct;3(5):570-9.
30 Estrogenic/antiestrogenic activities of a Epimedium koreanum extract and its major components: in vitro and in vivo studies. Food Chem Toxicol. 2012 Aug;50(8):2751-9. doi: 10.1016/j.fct.2012.05.017. Epub 2012 May 18.
31 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
32 Fingolimod interrupts the cross talk between estrogen metabolism and sphingolipid metabolism within prostate cancer cells. Toxicol Lett. 2018 Jul;291:77-85.
33 Assessment of estrogenic activity in some common essential oil constituents. J Pharm Pharmacol. 2002 Nov;54(11):1521-8. doi: 10.1211/002235702216.
34 In vitro estrogenic activity of Achillea millefolium L. Phytomedicine. 2007 Feb;14(2-3):147-52. doi: 10.1016/j.phymed.2006.05.005. Epub 2006 Jul 24.
35 Involvement of suppressor for Gal 1 in the ubiquitin/proteasome-mediated degradation of estrogen receptors. J Biol Chem. 2004 Mar 26;279(13):12020-6. doi: 10.1074/jbc.M312762200. Epub 2003 Dec 30.
36 Dioscin promotes osteoblastic proliferation and differentiation via Lrp5 and ER pathway in mouse and human osteoblast-like cell lines. J Biomed Sci. 2014 Apr 17;21(1):30. doi: 10.1186/1423-0127-21-30.
37 BPA modulates the WDR5/TET2 complex to regulate ER expression in eutopic endometrium and drives the development of endometriosis. Environ Pollut. 2021 Jan 1;268(Pt B):115748. doi: 10.1016/j.envpol.2020.115748. Epub 2020 Sep 28.
38 DNA demethylation and histone deacetylation inhibition co-operate to re-express estrogen receptor beta and induce apoptosis in prostate cancer cell-lines. Prostate. 2008 Feb 1;68(2):210-22. doi: 10.1002/pros.20673.
39 Actions of methyl-, propyl- and butylparaben on estrogen receptor- and - and the progesterone receptor in MCF-7 cancer cells and non-cancerous MCF-10A cells. Toxicol Lett. 2014 Nov 4;230(3):375-81. doi: 10.1016/j.toxlet.2014.08.012. Epub 2014 Aug 13.
40 Glyphosate induces human breast cancer cells growth via estrogen receptors. Food Chem Toxicol. 2013 Sep;59:129-36. doi: 10.1016/j.fct.2013.05.057. Epub 2013 Jun 10.
41 Responsiveness to estradiol-17beta and to phytoestrogens in primary human osteoblasts is modulated differentially by high glucose concentration. J Steroid Biochem Mol Biol. 2006 May;99(2-3):139-46. doi: 10.1016/j.jsbmb.2005.12.008. Epub 2006 Apr 18.
42 Effects of Bisphenol A on endogenous retroviral envelopes expression and trophoblast fusion in BeWo cells. Reprod Toxicol. 2019 Oct;89:35-44. doi: 10.1016/j.reprotox.2019.07.001. Epub 2019 Jul 3.
43 Comparison of the Toxicological Effects of Pesticides in Non-Tumorigenic MCF-12A and Tumorigenic MCF-7 Human Breast Cells. Int J Environ Res Public Health. 2022 Apr 7;19(8):4453. doi: 10.3390/ijerph19084453.
44 Unequivocal estrogen receptor-binding affinity of phthalate esters featured with ring hydroxylation and proper alkyl chain size. Arch Biochem Biophys. 2004 Nov 1;431(1):16-21. doi: 10.1016/j.abb.2004.07.028.
45 Phytoestrogens induce differential estrogen receptor alpha- or Beta-mediated responses in transfected breast cancer cells. Exp Biol Med (Maywood). 2005 Sep;230(8):558-68. doi: 10.1177/153537020523000807.
46 Modulation of cell cycles and apoptosis by apicidin in estrogen receptor (ER)-positive and-negative human breast cancer cells. Chem Biol Interact. 2008 Apr 15;172(3):235-44. doi: 10.1016/j.cbi.2008.01.007. Epub 2008 Feb 1.
47 Subtype-specific activation of estrogen receptors by a special extract of Rheum rhaponticum (ERr 731), its aglycones and structurally related compounds in U2OS human osteosarcoma cells. Phytomedicine. 2007 Nov;14(11):716-26. doi: 10.1016/j.phymed.2007.09.001.
48 Selective modulation of ER-beta by estradiol and xenoestrogens in human breast cancer cell lines. Cell Mol Life Sci. 2003 Mar;60(3):567-76. doi: 10.1007/s000180300048.
49 Catechol estrogens induce proliferation and malignant transformation in prostate epithelial cells. Toxicol Lett. 2013 Jul 18;220(3):247-58. doi: 10.1016/j.toxlet.2013.05.002. Epub 2013 May 15.
50 Estrogenic activities of Ginkgo biloba extracts. Life Sci. 2004 Jan 30;74(11):1325-35. doi: 10.1016/j.lfs.2003.06.045.
51 The Ah receptor inhibits estrogen-induced estrogen receptor beta in breast cancer cells. Biochem Biophys Res Commun. 2004 Jul 16;320(1):76-82. doi: 10.1016/j.bbrc.2004.05.132.
52 Designed modulation of sex steroid signaling inhibits telomerase activity and proliferation of human prostate cancer cells. Toxicol Appl Pharmacol. 2014 Oct 15;280(2):323-34. doi: 10.1016/j.taap.2014.08.002. Epub 2014 Aug 11.
53 Selectivity of natural, synthetic and environmental estrogens for zebrafish estrogen receptors. Toxicol Appl Pharmacol. 2014 Oct 1;280(1):60-9. doi: 10.1016/j.taap.2014.07.020. Epub 2014 Aug 8.
54 Development of a selective modulator of aryl hydrocarbon (Ah) receptor activity that exhibits anti-inflammatory properties. Chem Res Toxicol. 2010 May 17;23(5):955-66.
55 Estrogen receptor beta decreases survival of p53-defective cancer cells after DNA damage by impairing G?/M checkpoint signaling. Breast Cancer Res Treat. 2011 Jun;127(2):417-27. doi: 10.1007/s10549-010-1011-z. Epub 2010 Jul 10.
56 Soy-isoflavone-enriched foods and markers of lipid and glucose metabolism in postmenopausal women: interactions with genotype and equol production. Am J Clin Nutr. 2006 Mar;83(3):592-600. doi: 10.1093/ajcn.83.3.592.
57 Differential action of monohydroxylated polycyclic aromatic hydrocarbons with estrogen receptors and . Toxicol Sci. 2013 Apr;132(2):359-67. doi: 10.1093/toxsci/kfs287. Epub 2012 Sep 18.