Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZU4TJI)

DOT Name Receptor expression-enhancing protein 5 (REEP5)
Synonyms Polyposis locus protein 1; Protein TB2
Gene Name REEP5
Related Disease
Ovarian neoplasm ( )
Alzheimer disease ( )
Cardiac failure ( )
Cholestasis ( )
Colon cancer ( )
Colon carcinoma ( )
Colonic neoplasm ( )
Congestive heart failure ( )
Desmoid tumour ( )
Endometrial carcinoma ( )
Ewing sarcoma ( )
Familial adenomatous polyposis ( )
Gastric cancer ( )
Hepatocellular carcinoma ( )
Hereditary nonpolyposis colon cancer ( )
Lung cancer ( )
Lung carcinoma ( )
Lung neoplasm ( )
Major depressive disorder ( )
Neoplasm ( )
Squamous cell carcinoma ( )
Stomach cancer ( )
Tarsal-carpal coalition syndrome ( )
Tyrosinemia type I ( )
Benign neoplasm ( )
Obesity ( )
Acute myelogenous leukaemia ( )
Eosinophilic esophagitis ( )
MALT lymphoma ( )
UniProt ID
REEP5_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF03134
Sequence
MSAAMRERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCN
LIGFGYPAYISIKAIESPNKEDDTQWLTYWVVYGVFSIAEFFSDIFLSWFPFYYMLKCGF
LLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVN
LLGEEKKST
Function Plays an essential role in heart function and development by regulating the organization and function of the sarcoplasmic reticulum in cardiomyocytes.
Tissue Specificity Expressed in heart (at protein level) . Expressed in circumvallate papillae and testis .

Molecular Interaction Atlas (MIA) of This DOT

29 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Ovarian neoplasm DISEAFTY Definitive Biomarker [1]
Alzheimer disease DISF8S70 Strong Altered Expression [2]
Cardiac failure DISDC067 Strong Biomarker [3]
Cholestasis DISDJJWE Strong Biomarker [4]
Colon cancer DISVC52G Strong Biomarker [5]
Colon carcinoma DISJYKUO Strong Biomarker [5]
Colonic neoplasm DISSZ04P Strong Biomarker [6]
Congestive heart failure DIS32MEA Strong Biomarker [3]
Desmoid tumour DISGX357 Strong Genetic Variation [7]
Endometrial carcinoma DISXR5CY Strong Genetic Variation [8]
Ewing sarcoma DISQYLV3 Strong Biomarker [9]
Familial adenomatous polyposis DISW53RE Strong Biomarker [10]
Gastric cancer DISXGOUK Strong Biomarker [11]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [12]
Hereditary nonpolyposis colon cancer DISPA49R Strong Biomarker [9]
Lung cancer DISCM4YA Strong Biomarker [13]
Lung carcinoma DISTR26C Strong Biomarker [13]
Lung neoplasm DISVARNB Strong Biomarker [14]
Major depressive disorder DIS4CL3X Strong Genetic Variation [10]
Neoplasm DISZKGEW Strong Biomarker [15]
Squamous cell carcinoma DISQVIFL Strong Genetic Variation [16]
Stomach cancer DISKIJSX Strong Biomarker [11]
Tarsal-carpal coalition syndrome DISY90L2 Strong Biomarker [17]
Tyrosinemia type I DISP4OS8 Strong Biomarker [18]
Benign neoplasm DISDUXAD moderate Genetic Variation [19]
Obesity DIS47Y1K moderate Biomarker [20]
Acute myelogenous leukaemia DISCSPTN Limited Genetic Variation [21]
Eosinophilic esophagitis DISR8WSB Limited Altered Expression [22]
MALT lymphoma DIS1AVVE Limited Biomarker [23]
------------------------------------------------------------------------------------
⏷ Show the Full List of 29 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
10 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Receptor expression-enhancing protein 5 (REEP5). [24]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Receptor expression-enhancing protein 5 (REEP5). [25]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Receptor expression-enhancing protein 5 (REEP5). [26]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of Receptor expression-enhancing protein 5 (REEP5). [27]
Piroxicam DMTK234 Approved Piroxicam decreases the expression of Receptor expression-enhancing protein 5 (REEP5). [28]
Genistein DM0JETC Phase 2/3 Genistein decreases the expression of Receptor expression-enhancing protein 5 (REEP5). [29]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Receptor expression-enhancing protein 5 (REEP5). [30]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Receptor expression-enhancing protein 5 (REEP5). [31]
Coumestrol DM40TBU Investigative Coumestrol decreases the expression of Receptor expression-enhancing protein 5 (REEP5). [32]
methyl p-hydroxybenzoate DMO58UW Investigative methyl p-hydroxybenzoate decreases the expression of Receptor expression-enhancing protein 5 (REEP5). [33]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Drug(s)

References

1 Role of microsatellite instability in borderline ovarian tumors.Anticancer Res. 2003 Nov-Dec;23(6D):5139-41.
2 Hematopoietic prostaglandin D synthase and DP1 receptor are selectively upregulated in microglia and astrocytes within senile plaques from human patients and in a mouse model of Alzheimer disease.J Neuropathol Exp Neurol. 2007 Jun;66(6):469-80. doi: 10.1097/01.jnen.0000240472.43038.27.
3 REEP5 (Receptor Accessory Protein 5) Acts as a Sarcoplasmic Reticulum Membrane Sculptor to Modulate Cardiac Function.J Am Heart Assoc. 2018 Feb 3;7(3):e007205. doi: 10.1161/JAHA.117.007205.
4 Classification of Cholestatic and Necrotic Hepatotoxicants Using Transcriptomics on Human Precision-Cut Liver Slices.Chem Res Toxicol. 2016 Mar 21;29(3):342-51. doi: 10.1021/acs.chemrestox.5b00491. Epub 2016 Mar 9.
5 Anastomotic recurrence of colon cancer: Genetic analysis challenges the widely held theories of cancerous cells' intraluminal implantation and metachronous carcinogenesis.J Surg Oncol. 2016 Aug;114(2):228-36. doi: 10.1002/jso.24282. Epub 2016 May 9.
6 LOH at the sites of the DCC, APC, and TP53 tumor suppressor genes occurs in Barrett's metaplasia and dysplasia adjacent to adenocarcinoma of the esophagus.Hum Pathol. 1999 Dec;30(12):1508-14. doi: 10.1016/s0046-8177(99)90175-2.
7 Genetic testing for germline mutations of the APC gene in patients with apparently sporadic desmoid tumors but a family history of colorectal carcinoma.Dis Colon Rectum. 2005 Jun;48(6):1275-81. doi: 10.1007/s10350-004-0949-5.
8 Minimal microsatellite shift in microsatellite instability high endometrial cancer: a significant pitfall in diagnostic interpretation.Mod Pathol. 2019 May;32(5):650-658. doi: 10.1038/s41379-018-0179-3. Epub 2018 Nov 15.
9 Microsatellite instability in Ewing tumor is not associated with loss of mismatch repair protein expression.J Cancer Res Clin Oncol. 2007 Oct;133(10):749-59. doi: 10.1007/s00432-007-0220-2. Epub 2007 May 25.
10 Association of APC and REEP5 gene polymorphisms with major depression disorder and treatment response to antidepressants in a Han Chinese population.Gen Hosp Psychiatry. 2012 Sep-Oct;34(5):571-7. doi: 10.1016/j.genhosppsych.2012.05.015. Epub 2012 Jul 12.
11 Fisher linear discriminant analysis for classification and prediction of genomic susceptibility to stomach and colorectal cancers based on six STR loci in a northern Chinese Han population.PeerJ. 2019 May 28;7:e7004. doi: 10.7717/peerj.7004. eCollection 2019.
12 Association of over-expressed TFDP1 with progression of hepatocellular carcinomas. J Hum Genet. 2003;48(12):609-613.
13 The accessory proteins REEP5 and REEP6 refine CXCR1-mediated cellular responses and lung cancer progression.Sci Rep. 2016 Dec 14;6:39041. doi: 10.1038/srep39041.
14 Gene amplification of the transcription factor DP1 and CTNND1 in human lung cancer.J Pathol. 2010 Sep;222(1):89-98. doi: 10.1002/path.2732.
15 Recent Incidence Trend of Surgically Resected Esophagogastric Junction Adenocarcinoma and Microsatellite Instability Status in Japanese Patients.Digestion. 2019;99(1):6-13. doi: 10.1159/000494406. Epub 2018 Dec 14.
16 Analysis of APC allelic imbalance/loss of heterozygosity and APC protein expression in cutaneous squamous cell carcinomas.Cancer Genomics Proteomics. 2011 May-Jun;8(3):149-55.
17 Microsatellite instability in urothelial carcinoma of the upper urinary tract.J Urol. 2003 Oct;170(4 Pt 1):1151-4. doi: 10.1097/01.ju.0000086551.22844.cd.
18 Impaired DNA repair and genomic stability in hereditary tyrosinemia type 1.Gene. 2012 Mar 1;495(1):56-61. doi: 10.1016/j.gene.2011.12.021. Epub 2011 Dec 23.
19 The Wnt pathway, epithelial-stromal interactions, and malignant progression in phyllodes tumours.J Pathol. 2002 Apr;196(4):437-44. doi: 10.1002/path.1067.
20 DP1 receptor agonist, BW245C inhibits diet-induced obesity in ApoE(-/-) mice.Obes Res Clin Pract. 2018 Mar-Apr;12(2):229-241. doi: 10.1016/j.orcp.2017.05.003. Epub 2017 Jun 8.
21 Microsatellite instability is not an uncommon finding in adult de novo acute myeloid leukemia.Ann Hematol. 2005 Jun;84(6):368-75. doi: 10.1007/s00277-005-1035-3. Epub 2005 Mar 24.
22 Involvement of EP2 and EP4 Receptors in Eosinophilic Esophagitis: A Pilot Study.Dig Dis Sci. 2019 Oct;64(10):2806-2814. doi: 10.1007/s10620-019-05623-5. Epub 2019 Apr 15.
23 Analysis of microsatellite instability in gastric mucosa-associated lymphoid tissue lymphoma.Leuk Lymphoma. 2013 Apr;54(4):812-8. doi: 10.3109/10428194.2012.723211. Epub 2012 Sep 14.
24 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
25 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
26 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
27 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
28 Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
29 Quantitative proteomics and transcriptomics addressing the estrogen receptor subtype-mediated effects in T47D breast cancer cells exposed to the phytoestrogen genistein. Mol Cell Proteomics. 2011 Jan;10(1):M110.002170.
30 Epigenetic influences of low-dose bisphenol A in primary human breast epithelial cells. Toxicol Appl Pharmacol. 2010 Oct 15;248(2):111-21.
31 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
32 Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
33 Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.