Details of the Drug

General Information of Drug (ID: DM90WJH)

Drug Name
Interferon alfacon-1
Synonyms Advaferon; Infergen; Advaferon (TN); Infergen (TN); Interferon alfacon-1 (genetical recombination); Interferon alfacon-1 (USAN/INN); Interferon alfacon-1 (genetical recombination) (JAN)
Indication
Disease Entry ICD 11 Status REF
Hepatitis C 1E51 Approved [1]
Therapeutic Class
Anticancer Agents
Sequence
MCDLPQTHSLGNRRALILLAQMRRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHE
MIQQTFNLFSTKDSSAAWDESLLEKFYTELYQQLNDLEACVIQEVGVEETPLMNVDSILA
VKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSTNLQERLRRKE
ADMET Property
Half-life
The concentration or amount of drug in body reduced by one-half in 1.3 hours [2]
Cross-matching ID
DrugBank ID
DB00069
TTD ID
D0GA0A

Molecular Interaction Atlas of This Drug


Drug Therapeutic Target (DTT)
DTT Name DTT ID UniProt ID MOA REF
Interferon alpha/beta receptor 2 (IFNAR2) TTMQB37 INAR2_HUMAN Binder [3]
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Disease Different from Interferon alfacon-1 (Comorbidity)
DDI Drug Name DDI Drug ID Severity Mechanism Comorbidity REF
Remdesivir DMBFZ6L Moderate Increased risk of hepatotoxicity by the combination of Interferon alfacon-1 and Remdesivir. 1D6YCoronavirus Disease 2019 [1D6YCoronavirus Disease 2019] [4]
Thioguanine DM7NKEV Moderate Increased risk of hepatotoxicity by the combination of Interferon alfacon-1 and Thioguanine. Acute myeloid leukaemia [2A60] [5]
Bedaquiline DM3906J Moderate Increased risk of hepatotoxicity by the combination of Interferon alfacon-1 and Bedaquiline. Antimicrobial drug resistance [MG50-MG52] [6]
Aminophylline DML2NIB Moderate Decreased metabolism of Interferon alfacon-1 caused by Aminophylline mediated inhibition of CYP450 enzyme. Asthma [CA23] [4]
Roflumilast DMPGHY8 Moderate Additive immunosuppressive effects by the combination of Interferon alfacon-1 and Roflumilast. Asthma [CA23] [7]
Pexidartinib DMS2J0Z Major Increased risk of hepatotoxicity by the combination of Interferon alfacon-1 and Pexidartinib. Bone/articular cartilage neoplasm [2F7B] [8]
Oxtriphylline DMLHSE3 Moderate Decreased metabolism of Interferon alfacon-1 caused by Oxtriphylline mediated inhibition of CYP450 enzyme. Cough [MD12] [9]
PMID28870136-Compound-48 DMPIM9L Moderate Decreased metabolism of Interferon alfacon-1 caused by PMID28870136-Compound-48 mediated inhibition of CYP450 enzyme. Discovery agent [N.A.] [4]
Cannabidiol DM0659E Moderate Increased risk of hepatotoxicity by the combination of Interferon alfacon-1 and Cannabidiol. Epileptic encephalopathy [8A62] [7]
Brentuximab vedotin DMWLC57 Moderate Increased risk of peripheral neuropathy by the combination of Interferon alfacon-1 and Brentuximab vedotin. Hodgkin lymphoma [2B30] [10]
Efavirenz DMC0GSJ Moderate Increased risk of hepatotoxicity by the combination of Interferon alfacon-1 and Efavirenz. Human immunodeficiency virus disease [1C60-1C62] [11]
Zalcitabine DMH7MUV Moderate Increased risk of peripheral neuropathy by the combination of Interferon alfacon-1 and Zalcitabine. Human immunodeficiency virus disease [1C60-1C62] [12]
Mipomersen DMGSRN1 Major Increased risk of hepatotoxicity by the combination of Interferon alfacon-1 and Mipomersen. Hyper-lipoproteinaemia [5C80] [13]
BMS-201038 DMQTAGO Major Increased risk of hepatotoxicity by the combination of Interferon alfacon-1 and BMS-201038. Hyper-lipoproteinaemia [5C80] [14]
Polyethylene glycol DM4I1JP Moderate Increased risk of lowers seizure threshold by the combination of Interferon alfacon-1 and Polyethylene glycol. Irritable bowel syndrome [DD91] [15]
Methotrexate DM2TEOL Moderate Increased risk of hepatotoxicity by the combination of Interferon alfacon-1 and Methotrexate. Leukaemia [2A60-2B33] [7]
Denosumab DMNI0KO Moderate Additive immunosuppressive effects by the combination of Interferon alfacon-1 and Denosumab. Low bone mass disorder [FB83] [16]
Calaspargase pegol DMQZBXI Moderate Increased risk of hepatotoxicity by the combination of Interferon alfacon-1 and Calaspargase pegol. Malignant haematopoietic neoplasm [2B33] [17]
Cladribine DM3JDRP Major Additive immunosuppressive effects by the combination of Interferon alfacon-1 and Cladribine. Mature B-cell leukaemia [2A82] [7]
Idelalisib DM602WT Moderate Increased risk of hepatotoxicity by the combination of Interferon alfacon-1 and Idelalisib. Mature B-cell leukaemia [2A82] [18]
Alemtuzumab DMZL3IV Moderate Additive immunosuppressive effects by the combination of Interferon alfacon-1 and Alemtuzumab. Mature B-cell leukaemia [2A82] [19]
Clofarabine DMCVJ86 Moderate Increased risk of hepatotoxicity by the combination of Interferon alfacon-1 and Clofarabine. Mature B-cell lymphoma [2A85] [20]
Thalidomide DM70BU5 Moderate Increased risk of peripheral neuropathy by the combination of Interferon alfacon-1 and Thalidomide. Multiple myeloma [2A83] [12]
Bortezomib DMNO38U Moderate Increased risk of peripheral neuropathy by the combination of Interferon alfacon-1 and Bortezomib. Multiple myeloma [2A83] [12]
Tecfidera DM2OVDT Moderate Additive immunosuppressive effects by the combination of Interferon alfacon-1 and Tecfidera. Multiple sclerosis [8A40] [21]
Siponimod DM2R86O Major Additive immunosuppressive effects by the combination of Interferon alfacon-1 and Siponimod. Multiple sclerosis [8A40] [4]
Fingolimod DM5JVAN Major Additive immunosuppressive effects by the combination of Interferon alfacon-1 and Fingolimod. Multiple sclerosis [8A40] [22]
Ocrelizumab DMEZ2KH Moderate Additive immunosuppressive effects by the combination of Interferon alfacon-1 and Ocrelizumab. Multiple sclerosis [8A40] [23]
Ozanimod DMT6AM2 Major Additive immunosuppressive effects by the combination of Interferon alfacon-1 and Ozanimod. Multiple sclerosis [8A40] [7]
Omacetaxine mepesuccinate DMPU2WX Moderate Additive immunosuppressive effects by the combination of Interferon alfacon-1 and Omacetaxine mepesuccinate. Myeloproliferative neoplasm [2A20] [24]
Bupropion DM5PCS7 Major Increased risk of lowers seizure threshold by the combination of Interferon alfacon-1 and Bupropion. Nicotine use disorder [6C4A] [25]
Tramadol DMRQD04 Major Increased risk of lowers seizure threshold by the combination of Interferon alfacon-1 and Tramadol. Pain [MG30-MG3Z] [26]
Ropinirole DMA6S1D Moderate Decreased metabolism of Interferon alfacon-1 caused by Ropinirole mediated inhibition of CYP450 enzyme. Parkinsonism [8A00] [27]
Lindane DMB8CNL Moderate Increased risk of lowers seizure threshold by the combination of Interferon alfacon-1 and Lindane. Pediculosis [1G00] [28]
Leflunomide DMR8ONJ Major Increased risk of hepatotoxicity by the combination of Interferon alfacon-1 and Leflunomide. Rheumatoid arthritis [FA20] [29]
Trabectedin DMG3Y89 Moderate Increased risk of hepatotoxicity by the combination of Interferon alfacon-1 and Trabectedin. Solid tumour/cancer [2A00-2F9Z] [7]
Naltrexone DMUL45H Moderate Increased risk of hepatotoxicity by the combination of Interferon alfacon-1 and Naltrexone. Substance abuse [6C40] [30]
Azathioprine DMMZSXQ Moderate Additive immunosuppressive effects by the combination of Interferon alfacon-1 and Azathioprine. Transplant rejection [NE84] [4]
Ganciclovir DM1MBYQ Moderate Additive myelosuppressive effects by the combination of Interferon alfacon-1 and Ganciclovir. Virus infection [1A24-1D9Z] [4]
Valganciclovir DMS2IUH Moderate Additive myelosuppressive effects by the combination of Interferon alfacon-1 and Valganciclovir. Virus infection [1A24-1D9Z] [4]
⏷ Show the Full List of 40 DDI Information of This Drug

References

1 Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77.
2 Trend Analysis of a Database of Intravenous Pharmacokinetic Parameters in Humans for 1352 Drug Compounds
3 Retreating chronic hepatitis C with daily interferon alfacon-1/ribavirin after nonresponse to pegylated interferon/ribavirin: DIRECT results. Hepatology. 2009 Jun;49(6):1838-46.
4 Cerner Multum, Inc. "Australian Product Information.".
5 Product Information. Aubagio (teriflunomide). Genzyme Corporation, Cambridge, MA.
6 Product Information. Sirturo (bedaquiline). Janssen Pharmaceuticals, Titusville, NJ.
7 Cerner Multum, Inc. "UK Summary of Product Characteristics.".
8 Product Information. Turalio (pexidartinib). Daiichi Sankyo, Inc., Parsippany, NJ.
9 Jonkman JH, Nicholson KG, Farrow PR, et al "Effects of alpha-interferon on theophylline pharmacokinetics and metabolism." Br J Clin Pharmacol 27 (1989): 795-802. [PMID: 2757895]
10 Product Information. Accolate (zafirlukast). Zeneca Pharmaceuticals, Wilmington, DE.
11 Elsharkawy AM, Schwab U, McCarron B, et al. "Efavirenz induced acute liver failure requiring liver transplantation in a slow drug metaboliser." J Clin Virol 58 (2013): 331-3. [PMID: 23763943]
12 Argov Z, Mastaglia FL "Drug-induced peripheral neuropathies." Br Med J 1 (1979): 663-6. [PMID: 219931]
13 Product Information. Kynamro (mipomersen). Genzyme Corporation, Cambridge, MA.
14 Product Information. Juxtapid (lomitapide). Aegerion Pharmaceuticals Inc, Cambridge, MA.
15 Product Information. Suprep Bowel Prep Kit (magnesium/potassium/sodium sulfates). Braintree Laboratories, Braintree, MA.
16 Product Information. Prolia (denosumab). Amgen USA, Thousand Oaks, CA.
17 Al-Nawakil C, Willems L, Mauprivez C, et.al "Successful treatment of l-asparaginase-induced severe acute hepatotoxicity using mitochondrial cofactors." Leuk Lymphoma 55 (2014): 1670-4. [PMID: 24090500]
18 Product Information. Zydelig (idelalisib). Gilead Sciences, Foster City, CA.
19 Product Information. Campath (alemtuzumab) Berlex, Richmond, CA.
20 Product Information. Clolar (clofarabine). sanofi-aventis, Bridgewater, NJ.
21 Product Information. Vumerity (diroximel fumarate). Alkermes, Inc, Cambridge, MA.
22 Product Information. Gilenya (fingolimod). Novartis Pharmaceuticals, East Hanover, NJ.
23 Product Information. Ocrevus (ocrelizumab). Genentech, South San Francisco, CA.
24 Product Information. Synribo (omacetaxine). Teva Pharmaceuticals USA, North Wales, PA.
25 Product Information. Wellbutrin XL (buPROPion). GlaxoSmithKline, Philadelphia, PA.
26 Product Information. Ultram (tramadol). McNeil Pharmaceutical, Raritan, NJ.
27 Product Information. Noroxin (norfloxacin). Merck & Co, Inc, West Point, PA.
28 Matsuoka LY "Convulsions following application of gamma benzene hexachloride." J Am Acad Dermatol 5 (1981): 98-9. [PMID: 6168673]
29 Product Information. Arava (leflunomide). Hoechst Marion-Roussel Inc, Kansas City, MO.
30 Product Information. ReVia (naltrexone). DuPont Pharmaceuticals, Wilmington, DE.