Details of the Drug

General Information of Drug (ID: DM1A6RV)

Drug Name
Interferon beta-1a
Synonyms Avonex; Avonex (TN); Cinnovex (TN); Interferon beta-1a (USAN); Interferon beta-1a (genetical recombination); Interferon beta-1a (genetical recombination) (JAN); Rebif (TN)
Indication
Disease Entry ICD 11 Status REF
Multiple sclerosis 8A40 Approved [1]
Coronavirus Disease 2019 (COVID-19) 1D6Y Phase 3 [2]
Therapeutic Class
Immunomodulatory Agents
Drug Type
Protein/peptide drug
Sequence
MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIY
EMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSL
HLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
ADMET Property
Half-life
The concentration or amount of drug in body reduced by one-half in 10 hours [3]
Cross-matching ID
DrugBank ID
DB00060
TTD ID
D0V4JQ
Combinatorial Drugs (CBD) Click to Jump to the Detailed CBD Information of This Drug
Repurposed Drugs (RPD) Click to Jump to the Detailed RPD Information of This Drug

Molecular Interaction Atlas of This Drug


Drug Therapeutic Target (DTT)
DTT Name DTT ID UniProt ID MOA REF
Interferon-beta (IFNB1) TT4TZ8J IFNB_HUMAN Modulator [4]
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Same Disease as Interferon beta-1a
DDI Drug Name DDI Drug ID Severity Mechanism Disease REF
Tecfidera DM2OVDT Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Tecfidera. Multiple sclerosis [8A40] [5]
Siponimod DM2R86O Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Siponimod. Multiple sclerosis [8A40] [5]
Fingolimod DM5JVAN Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Fingolimod. Multiple sclerosis [8A40] [5]
Ozanimod DMT6AM2 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Ozanimod. Multiple sclerosis [8A40] [5]
Coadministration of a Drug Treating the Disease Different from Interferon beta-1a (Comorbidity)
DDI Drug Name DDI Drug ID Severity Mechanism Comorbidity REF
Remdesivir DMBFZ6L Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Remdesivir. 1D6YCoronavirus Disease 2019 [1D6YCoronavirus Disease 2019] [6]
Tretinoin DM49DUI Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Tretinoin. Acne vulgaris [ED80] [5]
Isotretinoin DM4QTBN Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Isotretinoin. Acne vulgaris [ED80] [5]
Nicotinamide DMUPE07 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Nicotinamide. Acquired cutaneous blood vessel malformation [EF20] [7]
Troglitazone DM3VFPD Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Troglitazone. Acute diabete complication [5A2Y] [5]
Pioglitazone DMKJ485 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Pioglitazone. Acute diabete complication [5A2Y] [5]
Acarbose DMRM3AW Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Acarbose. Acute diabete complication [5A2Y] [5]
Thioguanine DM7NKEV Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Thioguanine. Acute myeloid leukaemia [2A60] [7]
Tagraxofusp DM9HQ5U Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Tagraxofusp. Acute myeloid leukaemia [2A60] [5]
Gilteritinib DMTI0ZO Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Gilteritinib. Acute myeloid leukaemia [2A60] [5]
Chlorzoxazone DMCYVDT Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Chlorzoxazone. Acute pain [MG31] [5]
Oxandrolone DMU9MYJ Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Oxandrolone. Alcoholic liver disease [DB94] [5]
Tacrine DM51FY6 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Tacrine. Alzheimer disease [8A20] [5]
Inotersen DMJ93CT Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Inotersen. Amyloidosis [5D00] [5]
Dronedarone DMA8FS5 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Dronedarone. Angina pectoris [BA40] [5]
Oxymetholone DMFXUT8 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Oxymetholone. Aplastic anaemia [3A70] [5]
Voriconazole DMAOL2S Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Voriconazole. Aspergillosis [1F20] [5]
Posaconazole DMUL5EW Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Posaconazole. Aspergillosis [1F20] [5]
Zafirlukast DMHNQOG Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Zafirlukast. Asthma [CA23] [5]
Aminophylline DML2NIB Moderate Decreased metabolism of Interferon beta-1a caused by Aminophylline mediated inhibition of CYP450 enzyme. Asthma [CA23] [6]
Zileuton DMVRIC2 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Zileuton. Asthma [CA23] [5]
Clavulanate DM2FGRT Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Clavulanate. Bacterial infection [1A00-1C4Z] [7]
Erythromycin DM4K7GQ Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Erythromycin. Bacterial infection [1A00-1C4Z] [5]
Clarithromycin DM4M1SG Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Clarithromycin. Bacterial infection [1A00-1C4Z] [5]
Trovafloxacin DM6AN32 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Trovafloxacin. Bacterial infection [1A00-1C4Z] [5]
Sulfamethoxazole DMB08GE Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Sulfamethoxazole. Bacterial infection [1A00-1C4Z] [5]
Levofloxacin DMS60RB Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Levofloxacin. Bacterial infection [1A00-1C4Z] [5]
Moxifloxacin DMU8V4S Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Moxifloxacin. Bacterial infection [1A00-1C4Z] [5]
Troleandomycin DMUZNIG Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Troleandomycin. Bacterial infection [1A00-1C4Z] [5]
Minocycline DMVN5OH Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Minocycline. Bacterial infection [1A00-1C4Z] [5]
Telithromycin DMZ4P3A Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Telithromycin. Bacterial infection [1A00-1C4Z] [5]
Pexidartinib DMS2J0Z Major Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Pexidartinib. Bone/articular cartilage neoplasm [2F7B] [8]
Temozolomide DMKECZD Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Temozolomide. Brain cancer [2A00] [5]
Lomustine DMMWSUL Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Lomustine. Brain cancer [2A00] [5]
Lapatinib DM3BH1Y Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Lapatinib. Breast cancer [2C60-2C6Y] [5]
LY2835219 DM93VBZ Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and LY2835219. Breast cancer [2C60-2C6Y] [5]
Pralatrexate DMAO80I Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Pralatrexate. Breast cancer [2C60-2C6Y] [5]
Tucatinib DMBESUA Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Tucatinib. Breast cancer [2C60-2C6Y] [5]
Bosutinib DMTI8YE Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Bosutinib. Breast cancer [2C60-2C6Y] [5]
Trastuzumab Emtansine DMU1LXS Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Trastuzumab Emtansine. Breast cancer [2C60-2C6Y] [7]
Fluoxymesterone DMUHCF1 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Fluoxymesterone. Breast cancer [2C60-2C6Y] [5]
Atorvastatin DMF28YC Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Atorvastatin. Cardiovascular disease [BA00-BE2Z] [5]
Macitentan DMP79A1 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Macitentan. Cardiovascular disease [BA00-BE2Z] [5]
Chenodiol DMQ8JIK Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Chenodiol. Cholelithiasis [DC11] [5]
Phenylbutazone DMAYL0T Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Phenylbutazone. Chronic pain [MG30] [5]
Ketoprofen DMRKXPT Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Ketoprofen. Chronic pain [MG30] [5]
Regorafenib DMHSY1I Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Regorafenib. Colorectal cancer [2B91] [5]
Oxaliplatin DMQNWRD Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Oxaliplatin. Colorectal cancer [2B91] [5]
Intedanib DMSTA36 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Intedanib. Colorectal cancer [2B91] [5]
Oxtriphylline DMLHSE3 Moderate Decreased metabolism of Interferon beta-1a caused by Oxtriphylline mediated inhibition of CYP450 enzyme. Cough [MD12] [6]
Ivacaftor DMZC1HS Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Ivacaftor. Cystic fibrosis [CA25] [5]
Ethanol DMDRQZU Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Ethanol. Cystitis [GC00] [5]
Nefazodone DM4ZS8M Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Nefazodone. Depression [6A70-6A7Z] [5]
Duloxetine DM9BI7M Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Duloxetine. Depression [6A70-6A7Z] [5]
Milnacipran DMBFE74 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Milnacipran. Depression [6A70-6A7Z] [5]
Polatuzumab vedotin DMF6Y0L Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Polatuzumab vedotin. Diffuse large B-cell lymphoma [2A81] [5]
PMID28454500-Compound-96 DM2A75P Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and PMID28454500-Compound-96. Discovery agent [N.A.] [5]
PMID28870136-Compound-48 DMPIM9L Moderate Decreased metabolism of Interferon beta-1a caused by PMID28870136-Compound-48 mediated inhibition of CYP450 enzyme. Discovery agent [N.A.] [6]
Felbamate DM1V5ZS Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Felbamate. Epilepsy/seizure [8A61-8A6Z] [5]
Mephenytoin DM5UGDK Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Mephenytoin. Epilepsy/seizure [8A61-8A6Z] [5]
Valproate DMCFE9I Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Valproate. Epilepsy/seizure [8A61-8A6Z] [5]
Phenytoin DMNOKBV Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Phenytoin. Epilepsy/seizure [8A61-8A6Z] [5]
Fosphenytoin DMOX3LB Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Fosphenytoin. Epilepsy/seizure [8A61-8A6Z] [5]
Ethotoin DMXWOCP Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Ethotoin. Epilepsy/seizure [8A61-8A6Z] [5]
Carbamazepine DMZOLBI Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Carbamazepine. Epilepsy/seizure [8A61-8A6Z] [5]
Cannabidiol DM0659E Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Cannabidiol. Epileptic encephalopathy [8A62] [9]
Mefenamic acid DMK7HFI Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Mefenamic acid. Female pelvic pain [GA34] [5]
Dantrolene DM1D8XY Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Dantrolene. Fever [MG26] [5]
Itraconazole DMCR1MV Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Itraconazole. Fungal infection [1F29-1F2F] [5]
Caspofungin DMGQIPT Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Caspofungin. Fungal infection [1F29-1F2F] [5]
Terbinafine DMI6HUW Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Terbinafine. Fungal infection [1F29-1F2F] [5]
Clotrimazole DMMFCIH Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Clotrimazole. Fungal infection [1F29-1F2F] [5]
Fluconazole DMOWZ6B Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Fluconazole. Fungal infection [1F29-1F2F] [5]
Ketoconazole DMPZI3Q Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Ketoconazole. Fungal infection [1F29-1F2F] [5]
Atovaquone DMY4UMW Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Atovaquone. Fungal infection [1F29-1F2F] [5]
Sunitinib DMCBJSR Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Sunitinib. Gastrointestinal stromal tumour [2B5B] [5]
Ramipril DM2R68E Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Ramipril. Heart failure [BD10-BD1Z] [5]
Interferon alfacon-1 DM90WJH Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Interferon alfacon-1. Hepatitis virus infection [1E50-1E51] [5]
Lamivudine DMI347A Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Lamivudine. Hepatitis virus infection [1E50-1E51] [5]
177Lu-DOTATATE DMT8GVU Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and 177Lu-DOTATATE. Hepatitis virus infection [1E50-1E51] [5]
Isoniazid DM5JVS3 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Isoniazid. HIV-infected patients with tuberculosis [1B10-1B14] [5]
Rifampin DMA8J1G Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Rifampin. HIV-infected patients with tuberculosis [1B10-1B14] [7]
Brentuximab vedotin DMWLC57 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Brentuximab vedotin. Hodgkin lymphoma [2B30] [7]
Stavudine DM6DEK9 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Stavudine. Human immunodeficiency virus disease [1C60-1C62] [5]
Nevirapine DM6HX9B Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Nevirapine. Human immunodeficiency virus disease [1C60-1C62] [5]
Tipranavir DM8HJX6 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Tipranavir. Human immunodeficiency virus disease [1C60-1C62] [5]
Emtricitabine DMBMUWZ Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Emtricitabine. Human immunodeficiency virus disease [1C60-1C62] [5]
Efavirenz DMC0GSJ Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Efavirenz. Human immunodeficiency virus disease [1C60-1C62] [5]
Zalcitabine DMH7MUV Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Zalcitabine. Human immunodeficiency virus disease [1C60-1C62] [5]
Didanosine DMI2QPE Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Didanosine. Human immunodeficiency virus disease [1C60-1C62] [5]
Rilpivirine DMJ0QOW Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Rilpivirine. Human immunodeficiency virus disease [1C60-1C62] [5]
Abacavir DMMN36E Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Abacavir. Human immunodeficiency virus disease [1C60-1C62] [5]
Darunavir DMN3GCH Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Darunavir. Human immunodeficiency virus disease [1C60-1C62] [5]
Maraviroc DMTL94F Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Maraviroc. Human immunodeficiency virus disease [1C60-1C62] [5]
Simvastatin DM30SGU Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Simvastatin. Hyper-lipoproteinaemia [5C80] [5]
Fluvastatin DM4MDJY Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Fluvastatin. Hyper-lipoproteinaemia [5C80] [5]
Pravastatin DM6A0X7 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Pravastatin. Hyper-lipoproteinaemia [5C80] [5]
Lovastatin DM9OZWQ Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Lovastatin. Hyper-lipoproteinaemia [5C80] [5]
Fenofibrate DMFKXDY Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Fenofibrate. Hyper-lipoproteinaemia [5C80] [5]
Mipomersen DMGSRN1 Major Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Mipomersen. Hyper-lipoproteinaemia [5C80] [10]
Rosuvastatin DMMIQ7G Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Rosuvastatin. Hyper-lipoproteinaemia [5C80] [5]
Teriflunomide DMQ2FKJ Major Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Teriflunomide. Hyper-lipoproteinaemia [5C80] [11]
BMS-201038 DMQTAGO Major Increased risk of hepatotoxicity by the combination of Interferon beta-1a and BMS-201038. Hyper-lipoproteinaemia [5C80] [12]
Cerivastatin DMXCM7H Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Cerivastatin. Hyper-lipoproteinaemia [5C80] [5]
Moexipril DM26E4B Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Moexipril. Hypertension [BA00-BA04] [5]
Captopril DM458UM Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Captopril. Hypertension [BA00-BA04] [5]
Trandolapril DM4L6EU Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Trandolapril. Hypertension [BA00-BA04] [5]
Methyldopa DM5I621 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Methyldopa. Hypertension [BA00-BA04] [5]
Fosinopril DM9NJ52 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Fosinopril. Hypertension [BA00-BA04] [5]
Labetalol DMK8U72 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Labetalol. Hypertension [BA00-BA04] [5]
Perindopril DMOPZDT Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Perindopril. Hypertension [BA00-BA04] [5]
Quinapril DMR8H31 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Quinapril. Hypertension [BA00-BA04] [5]
Lisinopril DMUOK4C Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Lisinopril. Hypertension [BA00-BA04] [5]
Tolvaptan DMIWFRL Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Tolvaptan. Hypo-osmolality/hyponatraemia [5C72] [5]
Pirfenidone DM6VZFQ Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Pirfenidone. Idiopathic interstitial pneumonitis [CB03] [5]
Vitamin B3 DMQVRZH Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Vitamin B3. Inborn lipid metabolism error [5C52] [5]
Givosiran DM5PFIJ Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Givosiran. Inborn porphyrin/heme metabolism error [5C58] [5]
Febuxostat DMDEXQ0 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Febuxostat. Inborn purine/pyrimidine/nucleotide metabolism error [5C55] [5]
Meclofenamic acid DM05FXR Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Meclofenamic acid. Inflammatory spondyloarthritis [FA92] [7]
Polyethylene glycol DM4I1JP Moderate Increased risk of lowers seizure threshold by the combination of Interferon beta-1a and Polyethylene glycol. Irritable bowel syndrome [DD91] [13]
Methotrexate DM2TEOL Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Methotrexate. Leukaemia [2A60-2B33] [9]
DTI-015 DMXZRW0 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and DTI-015. Liver cancer [2C12] [5]
Testosterone DM7HUNW Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Testosterone. Low bone mass disorder [FB83] [7]
Crizotinib DM4F29C Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Crizotinib. Lung cancer [2C25] [5]
Erlotinib DMCMBHA Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Erlotinib. Lung cancer [2C25] [5]
Lurbinectedin DMEFRTZ Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Lurbinectedin. Lung cancer [2C25] [5]
Alectinib DMP1I6Y Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Alectinib. Lung cancer [2C25] [5]
BIBW 2992 DMTKD7Q Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and BIBW 2992. Lung cancer [2C25] [5]
Pralsetinib DMWU0I2 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Pralsetinib. Lung cancer [2C25] [5]
Capmatinib DMYCXKL Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Capmatinib. Lung cancer [2C25] [5]
Selpercatinib DMZR15V Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Selpercatinib. Lung cancer [2C25] [5]
Sulphadoxine DMZI2UF Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Sulphadoxine. Malaria [1F40-1F45] [5]
Inotuzumab ozogamicin DMAC130 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Inotuzumab ozogamicin. Malignant haematopoietic neoplasm [2B33] [5]
Idelalisib DM602WT Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Idelalisib. Mature B-cell leukaemia [2A82] [14]
IPI-145 DMWA24P Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and IPI-145. Mature B-cell leukaemia [2A82] [5]
Clofarabine DMCVJ86 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Clofarabine. Mature B-cell lymphoma [2A85] [15]
Blinatumomab DMGECIJ Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Blinatumomab. Mature B-cell lymphoma [2A85] [5]
Vincristine DMINOX3 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Vincristine. Mature B-cell lymphoma [2A85] [5]
Mercaptopurine DMTM2IK Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Mercaptopurine. Mature B-cell lymphoma [2A85] [5]
Ponatinib DMYGJQO Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Ponatinib. Mature B-cell lymphoma [2A85] [5]
Cytarabine DMZD5QR Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Cytarabine. Mature B-cell lymphoma [2A85] [5]
Arry-162 DM1P6FR Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Arry-162. Melanoma [2C30] [5]
Vemurafenib DM62UG5 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Vemurafenib. Melanoma [2C30] [5]
Ipilimumab DMJTIYK Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Ipilimumab. Melanoma [2C30] [5]
Dacarbazine DMNPZL4 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Dacarbazine. Melanoma [2C30] [5]
Interferon alfa-2B DMWCQP4 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Interferon alfa-2B. Melanoma [2C30] [5]
Danazol DML8KTN Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Danazol. Menstrual cycle bleeding disorder [GA20] [5]
Exjade DMHPRWG Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Exjade. Mineral absorption/transport disorder [5C64] [5]
Riluzole DMECBWN Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Riluzole. Motor neuron disease [8B60] [5]
Carfilzomib DM48K0X Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Carfilzomib. Multiple myeloma [2A83] [5]
Panobinostat DM58WKG Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Panobinostat. Multiple myeloma [2A83] [5]
Lenalidomide DM6Q7U4 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Lenalidomide. Multiple myeloma [2A83] [5]
Elotuzumab DMEYHG9 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Elotuzumab. Multiple myeloma [2A83] [5]
Bortezomib DMNO38U Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Bortezomib. Multiple myeloma [2A83] [5]
Pyrazinamide DM4IF32 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Pyrazinamide. Mycobacterium infection [1B10-1B21] [5]
Bexarotene DMOBIKY Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Bexarotene. Mycosis fungoides [2B01] [5]
Fedratinib DM4ZBK6 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Fedratinib. Myeloproliferative neoplasm [2A20] [5]
Nilotinib DM7HXWT Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Nilotinib. Myeloproliferative neoplasm [2A20] [5]
Imatinib DM7RJXL Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Imatinib. Myeloproliferative neoplasm [2A20] [5]
Bupropion DM5PCS7 Major Increased risk of lowers seizure threshold by the combination of Interferon beta-1a and Bupropion. Nicotine use disorder [6C4A] [5]
Entrectinib DMMPTLH Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Entrectinib. Non-small cell lung cancer [2C25] [5]
Orlistat DMRJSP8 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Orlistat. Obesity [5B80-5B81] [5]
Rofecoxib DM3P5DA Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Rofecoxib. Osteoarthritis [FA00-FA05] [5]
Valdecoxib DMAY7H4 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Valdecoxib. Osteoarthritis [FA00-FA05] [5]
Diclofenac DMPIHLS Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Diclofenac. Osteoarthritis [FA00-FA05] [7]
Naproxen DMZ5RGV Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Naproxen. Osteoarthritis [FA00-FA05] [5]
Etodolac DM6WJO9 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Etodolac. Pain [MG30-MG3Z] [5]
Ibuprofen DM8VCBE Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Ibuprofen. Pain [MG30-MG3Z] [5]
Tramadol DMRQD04 Major Increased risk of lowers seizure threshold by the combination of Interferon beta-1a and Tramadol. Pain [MG30-MG3Z] [16]
Piroxicam DMTK234 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Piroxicam. Pain [MG30-MG3Z] [5]
Acetaminophen DMUIE76 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Acetaminophen. Pain [MG30-MG3Z] [5]
Tolcapone DM8MNVO Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Tolcapone. Parkinsonism [8A00] [5]
Ropinirole DMA6S1D Moderate Decreased metabolism of Interferon beta-1a caused by Ropinirole mediated inhibition of CYP450 enzyme. Parkinsonism [8A00] [17]
Lindane DMB8CNL Moderate Increased risk of lowers seizure threshold by the combination of Interferon beta-1a and Lindane. Pediculosis [1G00] [18]
Ketorolac DMI4EL5 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Ketorolac. Postoperative inflammation [1A00-CA43] [5]
Bromfenac DMKB79O Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Bromfenac. Postoperative inflammation [1A00-CA43] [5]
ABIRATERONE DM8V75C Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and ABIRATERONE. Prostate cancer [2C82] [5]
Nilutamide DMFN07X Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Nilutamide. Prostate cancer [2C82] [5]
Flutamide DMK0O7U Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Flutamide. Prostate cancer [2C82] [5]
Infliximab DMH7OIA Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Infliximab. Psoriasis [EA90] [5]
Ambrisentan DMD1QXW Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Ambrisentan. Pulmonary hypertension [BB01] [5]
Bosentan DMIOGBU Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Bosentan. Pulmonary hypertension [BB01] [5]
Axitinib DMGVH6N Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Axitinib. Renal cell carcinoma [2C90] [5]
Sorafenib DMS8IFC Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Sorafenib. Renal cell carcinoma [2C90] [5]
Sulfadiazine DMTW3R8 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Sulfadiazine. Rheumatic fever [1B40] [5]
Meloxicam DM2AR7L Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Meloxicam. Rheumatoid arthritis [FA20] [5]
Sulindac DM2QHZU Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Sulindac. Rheumatoid arthritis [FA20] [5]
Celecoxib DM6LOQU Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Celecoxib. Rheumatoid arthritis [FA20] [5]
Tocilizumab DM7J6OR Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Tocilizumab. Rheumatoid arthritis [FA20] [5]
Oxaprozin DM9UB0P Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Oxaprozin. Rheumatoid arthritis [FA20] [5]
Flurbiprofen DMGN4BY Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Flurbiprofen. Rheumatoid arthritis [FA20] [5]
Sulfasalazine DMICA9H Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Sulfasalazine. Rheumatoid arthritis [FA20] [5]
Fenoprofen DML5VQ0 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Fenoprofen. Rheumatoid arthritis [FA20] [5]
Sarilumab DMOGNXY Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Sarilumab. Rheumatoid arthritis [FA20] [5]
Leflunomide DMR8ONJ Major Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Leflunomide. Rheumatoid arthritis [FA20] [11]
Indomethacin DMSC4A7 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Indomethacin. Rheumatoid arthritis [FA20] [5]
Pimozide DMW83TP Moderate Decreased metabolism of Interferon beta-1a caused by Pimozide mediated inhibition of CYP450 enzyme. Schizophrenia [6A20] [19]
Gefitinib DM15F0X Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Gefitinib. Solid tumour/cancer [2A00-2F9Z] [5]
Larotrectinib DM26CQR Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Larotrectinib. Solid tumour/cancer [2A00-2F9Z] [5]
PDX-101 DM6OC53 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and PDX-101. Solid tumour/cancer [2A00-2F9Z] [5]
LEE011 DMMX75K Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and LEE011. Solid tumour/cancer [2A00-2F9Z] [5]
Epirubicin DMPDW6T Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Epirubicin. Solid tumour/cancer [2A00-2F9Z] [6]
Methyltestosterone DMWLFGO Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Methyltestosterone. Solid tumour/cancer [2A00-2F9Z] [5]
Disulfiram DMCL2OK Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Disulfiram. Substance abuse [6C40] [5]
Naltrexone DMUL45H Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Naltrexone. Substance abuse [6C40] [5]
Zithromax DMN4H2O Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Zithromax. Syphilis [1A61-1A6Z] [5]
Fostamatinib DM6AUHV Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Fostamatinib. Thrombocytopenia [3B64] [5]
Eltrombopag DMOGFIX Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Eltrombopag. Thrombocytopenia [3B64] [5]
Lenvatinib DMB1IU4 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Lenvatinib. Thyroid cancer [2D10] [5]
Methimazole DM25FL8 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Methimazole. Thyrotoxicosis [5A02] [5]
Propylthiouracil DM6D7N8 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Propylthiouracil. Thyrotoxicosis [5A02] [5]
Tizanidine DMR2IQ4 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Tizanidine. Tonus and reflex abnormality [MB47] [5]
Trimetrexate DMDEA85 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Trimetrexate. Toxoplasmosis [1F57] [5]
Azathioprine DMMZSXQ Moderate Additive immunosuppressive effects by the combination of Interferon beta-1a and Azathioprine. Transplant rejection [NE84] [6]
Aminosalicylic acid DMENSL5 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Aminosalicylic acid. Tuberculosis [1B10-1B12] [5]
Ethambutol DMR87LC Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Ethambutol. Tuberculosis [1B10-1B12] [5]
Nitrofurantoin DM7PQIK Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Nitrofurantoin. Urinary tract infection [GC08] [5]
Sulfamethizole DMGCHDS Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Sulfamethizole. Urinary tract infection [GC08] [5]
Sulfisoxazole DMXLT8C Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Sulfisoxazole. Urinary tract infection [GC08] [5]
Elagolix DMB2C0E Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Elagolix. Uterine fibroid [2E86] [5]
Amiodarone DMUTEX3 Moderate Increased risk of hepatotoxicity by the combination of Interferon beta-1a and Amiodarone. Ventricular tachyarrhythmia [BC71] [5]
⏷ Show the Full List of 221 DDI Information of This Drug

References

1 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8339).
2 ClinicalTrials.gov (NCT04315948) Trial of Treatments for COVID-19 in Hospitalized Adults
3 Trend Analysis of a Database of Intravenous Pharmacokinetic Parameters in Humans for 1352 Drug Compounds
4 Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
5 Product Information. Avonex (interferon beta-1a). Biogen, Cambridge, MA.
6 Cerner Multum, Inc. "Australian Product Information.".
7 Product Information. Betaseron (interferon beta-1b). Berlex, Richmond, CA.
8 Product Information. Turalio (pexidartinib). Daiichi Sankyo, Inc., Parsippany, NJ.
9 Cerner Multum, Inc. "UK Summary of Product Characteristics.".
10 Product Information. Kynamro (mipomersen). Genzyme Corporation, Cambridge, MA.
11 Canadian Pharmacists Association.
12 Product Information. Juxtapid (lomitapide). Aegerion Pharmaceuticals Inc, Cambridge, MA.
13 Product Information. Suprep Bowel Prep Kit (magnesium/potassium/sodium sulfates). Braintree Laboratories, Braintree, MA.
14 Product Information. Zydelig (idelalisib). Gilead Sciences, Foster City, CA.
15 Product Information. Clolar (clofarabine). sanofi-aventis, Bridgewater, NJ.
16 Product Information. Ultram (tramadol). McNeil Pharmaceutical, Raritan, NJ.
17 Product Information. Noroxin (norfloxacin). Merck & Co, Inc, West Point, PA.
18 Matsuoka LY "Convulsions following application of gamma benzene hexachloride." J Am Acad Dermatol 5 (1981): 98-9. [PMID: 6168673]
19 Krahenbuhl S, Sauter B, Kupferschmidt H, Krause M, Wyss PA, Meier PJ "Case report: reversible QT prolongation with torsades de pointes in a patient with pimozide intoxication." Am J Med Sci 309 (1995): 315-6. [PMID: 7771501]