Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DT9C1TS)

• DTP Name: Organic anion transporting polypeptide 1B3 (SLCO1B3)
• Gene Name: SLCO1B3
• UniProt ID: Q9NPD5 (SO1B3_HUMAN)
• VARIDT ID: DTD0030
• Synonyms: LST-2; LST-3TM13; LST2; LST3; Liver-specific organic anion transporter 2; OATP-8; OATP1B3; OATP8; Organic anion transporter 8; Organic anion-transporting polypeptide 8; SLC21A8; SLCO1B3; Solute carrier family 21 member 8; Solute carrier organic anion transporter family member 1B3
• DTP Family: Organo Anion Transporter (OAT) Family
• Tissue Specificity: Highly expressed in liver, in particular atthe basolateral membrane of hepatocytes near the central vein. Notdetected in other tissues. Highly expressed in some cancer celllines derived from colon, pancreas, liver and gall bladder.
• Sequence:
  MDQHQHLNKTAESASSEKKKTRRCNGFKMFLAALSFSYIAKALGGIIMKISITQIERRFD
  ISSSLAGLIDGSFEIGNLLVIVFVSYFGSKLHRPKLIGIGCLLMGTGSILTSLPHFFMGY
  YRYSKETHINPSENSTSSLSTCLINQTLSFNGTSPEIVEKDCVKESGSHMWIYVFMGNML
  RGIGETPIVPLGISYIDDFAKEGHSSLYLGSLNAIGMIGPVIGFALGSLFAKMYVDIGYV
  DLSTIRITPKDSRWVGAWWLGFLVSGLFSIISSIPFFFLPKNPNKPQKERKISLSLHVLK
  TNDDRNQTANLTNQGKNVTKNVTGFFQSLKSILTNPLYVIFLLLTLLQVSSFIGSFTYVF
  KYMEQQYGQSASHANFLLGIITIPTVATGMFLGGFIIKKFKLSLVGIAKFSFLTSMISFL
  FQLLYFPLICESKSVAGLTLTYDGNNSVASHVDVPLSYCNSECNCDESQWEPVCGNNGIT
  YLSPCLAGCKSSSGIKKHTVFYNCSCVEVTGLQNRNYSAHLGECPRDNTCTRKFFIYVAI
  QVINSLFSATGGTTFILLTVKIVQPELKALAMGFQSMVIRTLGGILAPIYFGALIDKTCM
  KWSTNSCGAQGACRIYNSVFFGRVYLGLSIALRFPALVLYIVFIFAMKKKFQGKDTKASD
  NERKVMDEANLEFLNNGEHFVPSAGTDSKTCNLDMQDNAAAN
• Function: This transporter involved in the clearance of bile acids and organic anions from the liver. Mediates the Na(+)-independent uptake of organic anions such as 17-beta-glucuronosyl estradiol, taurocholate, triiodothyronine (T3), leukotriene C4, dehydroepiandrosterone sulfate (DHEAS), methotrexate and sulfobromophthalein (BSP).
• Endogenous Substrate(s): Cholate; Cholecystokinin; 17Beta-glucuronosyl estradiol; Cholecystokinin 8; Monoglucuronosyl bilirubin; Tauroursodeoxycholate
• TCDB ID: 2.A.60.1.12
• Gene ID: 28234
• Reactome Pathway:
  Heme degradation (R-HSA-189483)
  Defective SLCO1B3 causes hyperbilirubinemia, Rotor type (HBLRR) (R-HSA-5619058)
  Transport of organic anions (R-HSA-879518)
  Atorvastatin ADME (R-HSA-9754706)
  Recycling of bile acids and salts (R-HSA-159418)

Molecular Interaction Atlas (MIA) of This DTP

51 Approved Drug(s) Transported by This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Acocantherin	DM7JT24	Atrial fibrillation	BC81.3	Approved	[2]
Atorvastatin	DMF28YC	Cardiovascular disease	BA00-BE2Z	Approved	[3]
Bosentan	DMIOGBU	Pulmonary arterial hypertension	BB01.0	Approved	[4]
Cefmetazole	DM42W1B	Bacterial infection	1A00-1C4Z	Approved	[5]
Cefoperazone	DM53PV8	Bacterial infection	1A00-1C4Z	Approved	[5]
Ceftriaxone	DMCEW64	Bacterial infection	1A00-1C4Z	Approved	[5]
Cerivastatin	DMXCM7H	Hyperlipidaemia	5C80	Approved	[3]
Cilostazol	DMZMSCT	Intermittent claudication	BD40.00	Approved	[6]
Crizotinib	DM4F29C	Non-small-cell lung cancer	2C25.Y	Approved	[7]
Dasatinib	DMJV2EK	Chronic myelogenous leukaemia	2A20.0	Approved	[7]
Dehydroepiandrosterone sulfate	DM4Q80H	Dyspareunia	GA12	Approved	[8]
Diclofenac	DMPIHLS	Osteoarthritis	FA00-FA05	Approved	[9]
Digoxin	DMQCTIH	Arrhythmia	BC9Z	Approved	[2]
Docetaxel	DMDI269	Solid tumour/cancer	2A00-2F9Z	Approved	[10]
Enalapril	DMNFUZR	Hypertension	BA00-BA04	Approved	[11]
Erythromycin	DM4K7GQ	Bacterial infection	1A00-1C4Z	Approved	[12]
Estrone sulfate	DMVBIZL	Menopausal and postmenopausal disorder	GA30	Approved	[13]
Etoposide	DMNH3PG	Solid tumour/cancer	2A00-2F9Z	Approved	[13]
Fexofenadine	DM17ONX	Allergic rhinitis	CA08.0	Approved	[14]
Fluorescein	DMQTFAO	Ocular disease	1F00.1Z	Approved	[15]
Fluvastatin	DM4MDJY	Hypercholesterolaemia	5C80.0	Approved	[16]
Gadobenate dimeglumine	DM4VAOG	Schizophrenia	6A20	Approved	[17]
Gefitinib	DM15F0X	Solid tumour/cancer	2A00-2F9Z	Approved	[7]
Glutathione	DMAHMT9	Human immunodeficiency virus infection	1C62	Approved	[18]
Hydroxyurea	DMOQVU9	Chronic myelogenous leukaemia	2A20.0	Approved	[19]
Imatinib	DM7RJXL	Acute lymphoblastic leukaemia	2A85	Approved	[7]
Indocyanine green	DM2NQUY	Gastrointestinal disease	DE2Z	Approved	[20]
Liothyronine	DM6IR3P	Hypothyroidism	5A00	Approved	[8]
Mesalazine	DMOL5IU	Ulcerative colitis	DD71	Approved	[21]
Methotrexate	DM2TEOL	leukaemia	2A60-2B33	Approved	[8]
Mycophenolate mofetil	DMPQAGE	Organ transplant rejection	NE84	Approved	[22]
Nateglinide	DMLK2QH	Diabetic complication	5A2Y	Approved	[3]
Nilotinib	DM7HXWT	Chronic myelogenous leukaemia	2A20.0	Approved	[7]
Olmesartan medoxomil	DMWBHRY	High blood pressure	BA00	Approved	[23]
Paclitaxel	DMLB81S	Breast cancer	2C60-2C65	Approved	[24]
Pitavastatin	DMJH792	Hyperlipidemia	5C80.Z	Approved	[12]
Pitavastatin calcium	DM1UJO0	Dyslipidemia	5C80-5C81	Approved	[25]
Pravastatin	DM6A0X7	Hypercholesterolaemia	5C80.0	Approved	[26]
Rifampin	DMA8J1G	Tuberculosis	1B10-1B1Z	Approved	[27]
Romidepsin	DMT5GNL	Cutaneous T-cell lymphoma	2B01	Approved	[28]
Rosuvastatin	DMMIQ7G	Hypercholesterolaemia	5C80.0	Approved	[29]
Sorafenib	DMS8IFC	Hepatocellular carcinoma	2C12.02	Approved	[7]
Sunitinib	DMCBJSR	Gastrointestinal cancer	2C11	Approved	[7]
Technetium (99MTC) mebrofenin	DMUEWM3	Diagnostic imaging	N.A.	Approved	[30]
Telmisartan	DMS3GX2	Hypertension	BA00-BA04	Approved	[31]
Testosterone	DM7HUNW	Osteoporosis	FB83.0	Approved	[32]
Valsartan	DMREUQ6	Hypertension	BA00-BA04	Approved	[33]
Vandetanib	DMRICNP	Solid tumour/cancer	2A00-2F9Z	Approved	[7]
Vemurafenib	DM62UG5	Melanoma	2C30	Approved	[7]
Warfarin	DMJYCVW	Atrial fibrillation	BC81.3	Approved	[4]
Primovist	DM37FKA	Lung cancer	2C25.0	Phase 4	[34]

7 Clinical Trial Drug(s) Transported by This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Atrasentan	DMM74PK	Diabetic nephropathy	GB61.Z	Phase 3	[35]
Benzylpenicillin	DMS9503	N. A.	N. A.	Phase 3	[36]
BQ-123	DM0MO8I	Pulmonary arterial hypertension	BB01.0	Phase 2	[2]
Danoprevir	DM20MDU	Hepatitis C virus infection	1E51.1	Phase 2	[3]
LE-SN38	DMW50NF	Colorectal cancer	2B91.Z	Phase 2	[10]
Sodium taurocholate	DM3GO0J	Type-2 diabetes	5A11	Phase 1/2	[8]
Taurocholic acid	DM2LZ8F	Type-2 diabetes	5A11	Phase 1/2	[13]

7 Investigative Drug(s) Transported by This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Amanitin	DM59IT4	Discovery agent	N.A.	Investigative	[36]
Bilirubin	DMI0V4O	Discovery agent	N.A.	Investigative	[37]
Bromsulphthalein	DM9W2ZV	N. A.	N. A.	Investigative	[2]
CCK-8	DMN0J4W	N. A.	N. A.	Investigative	[38]
Fluo-3	DMLO9FU	Discovery agent	N.A.	Investigative	[13]
Glycocholic acid	DM0SXNM	Discovery agent	N.A.	Investigative	[2]
[3H]estradiol-17beta-glucuronide	DM3KJ45	Discovery agent	N.A.	Investigative	[39]

Molecular Expression Atlas (MEA) of This DTP

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Acute myelocytic leukaemia	2B33.1	Bone marrow	4.93E-05	-5.25E-02	-3.14E-01
Adrenocortical carcinoma	2D11.Z	Kidney	4.39E-01	-2.04E-02	-1.19E-01
Alopecia	ED70	Skin from scalp	7.94E-01	-4.14E-02	-2.34E-01
Alzheimer's disease	8A20	Entorhinal cortex	9.69E-01	1.16E-03	3.56E-03
Ankylosing spondylitis	FA92.0	Pheripheral blood	9.41E-01	-3.03E-02	-1.71E-01
Aortic stenosis	BB70	Calcified aortic valve	5.19E-01	-4.89E-03	-2.25E-02
Apnea	7A40	Hyperplastic tonsil	2.71E-01	4.34E-02	2.21E-01
Arthropathy	FA00-FA5Z	Peripheral blood	7.51E-01	2.07E-02	1.29E-01
Asthma	CA23	Nasal and bronchial airway	1.89E-10	2.54E+00	1.39E+00
Atopic dermatitis	EA80	Skin	2.09E-03	1.23E-01	1.08E+00
Autism	6A02	Whole blood	1.91E-01	4.38E-02	2.73E-01
Autoimmune uveitis	9A96	Peripheral monocyte	3.07E-02	1.33E-01	8.39E-01
Autosomal dominant monocytopenia	4B04	Whole blood	2.73E-02	1.31E-01	1.22E+00
Bacterial infection of gingival	1C1H	Gingival tissue	2.93E-03	-6.98E-02	-3.12E-01
Batten disease	5C56.1	Whole blood	6.72E-01	-1.20E-02	-1.10E-01
Behcet's disease	4A62	Peripheral blood	5.93E-01	1.43E-01	7.52E-01
Bipolar disorder	6A60-6A6Z	Prefrontal cortex	2.21E-02	9.48E-02	6.45E-01
Bladder cancer	2C94	Bladder tissue	6.97E-08	9.09E-02	5.81E-01
Breast cancer	2C60-2C6Z	Breast tissue	4.86E-01	-5.39E-02	-2.84E-01
Cardioembolic stroke	8B11.20	Whole blood	2.95E-01	4.49E-02	2.13E-01
Cervical cancer	2C77	Cervical tissue	6.36E-01	-3.47E-01	-2.65E-01
Childhood onset rheumatic disease	FA20.Z	Peripheral blood	5.36E-01	2.34E-02	1.67E-01
Chronic hepatitis C	1E51.1	Whole blood	3.27E-01	3.76E-02	2.29E-01
Chronic obstructive pulmonary disease	CA22	Lung tissue	3.20E-01	2.15E-02	1.15E-01
Chronic obstructive pulmonary disease	CA22	Small airway epithelium	1.40E-02	-4.58E-02	-1.12E-01
Chronic rhinosinusitis	CA0A	Sinus mucosa tissue	8.37E-02	6.07E-01	2.69E+00
Colon cancer	2B90	Colon tissue	1.63E-158	1.56E+00	3.75E+00
Coronary artery disease	BA80-BA8Z	Peripheral blood	4.71E-01	-3.34E-02	-1.22E-01
Diffuse large B-cell lymphoma	2A81	Tonsil tissue	6.64E-01	-9.32E-03	-4.05E-02
Endometriosis	GA10	Endometrium tissue	7.75E-01	3.79E-03	1.43E-02
Familial hypercholesterolemia	5C80.00	Peripheral blood	1.88E-01	6.89E-02	7.14E-01
Familial hypercholesterolemia	5C80.00	Whole blood	1.65E-01	-6.07E-02	-3.77E-01
Gastric cancer	2B72	Gastric tissue	8.76E-03	4.48E-01	1.50E+00
Glioblastopma	2A00.00	Nervous tissue	1.59E-10	1.01E-01	3.62E-01
Glioma	2A00.0Y-2A00.0Z	White matter tissue	2.96E-02	-1.22E-01	-6.03E-01
Head and neck cancer	2D42	Head and neck tissue	1.86E-13	4.08E-01	7.55E-01
HIV-associated neurocognitive impairment	8A2Y-8A2Z	White matter tissue	4.96E-01	-3.44E-02	-2.84E-01
Huntington's disease	8A01.10	Whole blood	4.28E-02	-6.30E-02	-5.39E-01
Idiopathic pulmonary fibrosis	CB03.4	Lung tissue	8.11E-02	8.89E-02	5.62E-01
Immunodeficiency	4A00-4A20	Peripheral blood	7.48E-01	5.71E-02	5.27E-01
Influenza	1.00E+30	Whole blood	6.10E-01	5.26E-02	8.59E-01
Interstitial cystitis	GC00.3	Bladder tissue	5.99E-01	-4.97E-03	-8.00E-02
Intracranial aneurysm	8B01.0	Intracranial artery	1.18E-02	-1.16E-01	-5.16E-01
Irritable bowel syndrome	DD91.0	Rectal colon tissue	4.25E-02	9.85E-02	2.50E-01
Ischemic stroke	8B11	Peripheral blood	2.24E-01	1.24E-02	7.67E-02
Juvenile idiopathic arthritis	FA24	Peripheral blood	5.72E-01	1.95E-02	6.17E-02
Lateral sclerosis	8B60.4	Cervical spinal cord	4.11E-01	4.27E-02	2.48E-01
Lateral sclerosis	8B60.4	Skin	9.37E-01	1.31E-02	6.46E-02
Liver cancer	2C12.0	Liver tissue	1.48E-59	-3.95E+00	-5.81E+00
Liver failure	DB99.7-DB99.8	Liver tissue	7.11E-04	-4.42E+00	-8.15E+00
Lung cancer	2C25	Lung tissue	3.46E-61	1.83E-01	7.90E-01
Lupus erythematosus	4A40	Whole blood	9.22E-01	-7.31E-02	-1.96E-01
Major depressive disorder	6A70-6A7Z	Whole blood	1.00E+00	1.02E-02	5.01E-02
Major depressive disorder	6A70-6A7Z	Hippocampus	3.85E-03	1.01E-01	7.72E-01
Melanoma	2C30	Skin	1.98E-01	-7.45E-02	-3.24E-01
Multiple myeloma	2A83.1	Bone marrow	2.19E-02	4.44E-02	4.09E-01
Multiple myeloma	2A83.1	Peripheral blood	6.12E-01	1.16E-01	7.74E-01
Multiple sclerosis	8A40	Plasmacytoid dendritic cells	9.32E-01	-1.68E-02	-1.21E-01
Myelodysplastic syndrome	2A36-2A3Z	Bone marrow	9.92E-01	-7.89E-03	-5.24E-02
Myelofibrosis	2A20.2	Whole blood	5.08E-04	1.95E-01	1.57E+00
Myocardial infarction	BA41-BA50	Peripheral blood	2.17E-01	1.81E-01	3.61E-01
Myopathy	8C70.6	Muscle tissue	3.21E-01	5.75E-02	2.16E-01
Neonatal sepsis	KA60	Whole blood	1.20E-02	-5.15E-02	-2.71E-01
Neuroectodermal tumour	2A00.11	Brain stem tissue	1.45E-02	9.14E-02	6.66E-01
Non-alcoholic fatty liver disease	DB92	Liver tissue	6.32E-01	-6.16E-02	-8.28E-02
Obesity related type 2 diabetes	5A11	Omental adipose tissue	8.12E-01	2.69E-02	2.21E-01
Olive pollen allergy	CA08.00	Peripheral blood	1.19E-01	-2.74E-02	-4.39E-01
Oral cancer	2B6E	Oral tissue	7.27E-35	1.22E+00	7.24E+00
Osteoarthritis	FA00-FA0Z	Synovial tissue	1.49E-01	8.37E-03	9.66E-02
Osteoporosis	FB83.1	Bone marrow	6.27E-02	1.74E-01	2.30E+00
Ovarian cancer	2C73	Ovarian tissue	4.48E-08	2.47E-01	1.40E+00
Pancreatic cancer	2C10	Pancreas	2.10E-05	-2.39E-02	-3.15E-02
Parkinson's disease	8A00.0	Substantia nigra tissue	8.56E-01	3.16E-02	2.99E-01
Pediatric respiratory syncytial virus infection	CA40.11	Peripheral blood	8.29E-01	-5.97E-03	-4.70E-02
Pituitary cancer	2D12	Pituitary tissue	7.96E-01	2.13E-03	4.75E-03
Pituitary gonadotrope tumour	2D12	Pituitary tissue	7.13E-01	4.25E-02	2.01E-01
Polycystic ovary syndrome	5A80.1	Vastus lateralis muscle	2.10E-01	3.36E-02	3.86E-01
Polycythemia vera	2A20.4	Whole blood	6.00E-03	5.21E-02	4.46E-01
Pompe disease	5C51.3	Biceps muscle	1.92E-01	-5.10E-02	-1.12E+00
Preterm birth	KA21.4Z	Myometrium	7.67E-01	0.00E+00	0.00E+00
Prostate cancer	2C82	Prostate	2.08E-04	3.94E-02	1.17E-01
Psoriasis	EA90	Skin	1.60E-03	-7.70E-02	-3.78E-01
Rectal cancer	2B92	Rectal colon tissue	3.97E-10	1.24E+00	3.81E+00
Renal cancer	2C90-2C91	Kidney	5.58E-04	1.35E-01	1.08E+00
Retinoblastoma	2D02.2	Uvea	8.32E-03	1.35E-01	1.39E+00
Rheumatoid arthritis	FA20	Synovial tissue	7.74E-01	-2.06E-02	-1.41E-01
Rhinovirus infection	CA42.1	Nasal epithelium tissue	9.78E-01	-2.44E-01	-3.05E-01
Schizophrenia	6A20	Prefrontal cortex	4.67E-01	7.28E-03	4.43E-02
Schizophrenia	6A20	Superior temporal cortex	4.47E-03	4.60E-02	6.32E-01
Scleroderma	4A42.Z	Whole blood	5.46E-02	6.67E-02	4.39E-01
Seizure	8A60-8A6Z	Whole blood	4.65E-01	-3.40E-02	-1.53E-01
Sensitive skin	EK0Z	Skin	8.21E-01	-8.15E-02	-5.34E-01
Sepsis with septic shock	1G41	Whole blood	2.84E-01	-4.40E-02	-1.85E-01
Shwachman-Diamond syndrome	3A70.0	Bone marrow	1.20E-01	2.94E-01	2.91E+00
Sickle cell disease	3A51.0-3A51.3	Peripheral blood	7.21E-01	5.01E-03	5.22E-02
Simpson golabi behmel syndrome	LD2C	Adipose tissue	4.56E-01	3.96E-02	7.74E-01
Sjogren's syndrome	4A43.2	Salivary gland tissue	9.13E-01	2.35E-01	3.97E-01
Skin cancer	2C30-2C3Z	Skin	2.61E-01	-1.13E-02	-5.09E-02
Thrombocythemia	3B63	Whole blood	4.64E-01	3.84E-02	2.91E-01
Thrombocytopenia	3B64	Whole blood	9.38E-01	-1.40E-01	-6.03E-01
Thyroid cancer	2D10	Thyroid	7.57E-04	7.55E-03	3.42E-02
Tibial muscular dystrophy	8C75	Muscle tissue	1.74E-03	-8.06E-02	-4.03E-01
Tuberous sclerosis complex	LD2D.2	Perituberal tissue	3.66E-02	3.18E-01	4.81E+00
Type 2 diabetes	5A11	Liver tissue	5.85E-01	1.81E-01	6.68E-01
Ureter cancer	2C92	Urothelium	8.54E-01	2.15E-02	1.03E-01
Uterine cancer	2C78	Endometrium tissue	8.39E-02	-6.52E-02	-8.24E-02
Vitiligo	ED63.0	Skin	5.52E-01	4.27E-02	2.79E-01

Drug Affinity of This DTP Assessed by Cell Line

Approved Drug(s)

Drug Name	Highest Status	Cell Line	Affinity	REF
Atorvastatin	Approved	Human embryonic kidney cells (HEK293)-OATP1B3	Km = 0.73 microM	[38]
Bosentan	Approved	Chinese hamster ovary (CHO) cells-OATP1B3	Km = 141 microM	[4]
Cilostazol	Approved	Human embryonic kidney cells (HEK293)-OATP1B3	Km = 2.7 microM	[6]
Fexofenadine	Approved	Human embryonic kidney cells (HEK293)-OATP1B3	Km = 108 microM	[14]
Fluvastatin	Approved	Madin-Darby canine kidney cells (MDCKII)-OATP1B3	Km = 7 microM	[40]
Liothyronine	Approved	Oocytes-OATP1B3	Km = 6.4 microM	[8]
Mesalazine	Approved	Human embryonic kidney cells (HEK293)-OATP1B3	Km = 77.4 microM	[21]
Methotrexate	Approved	Madin-Darby canine kidney (MDCK) cells-OATP1B3	Km = 39.4 microM	[8]
Methotrexate	Approved	Oocytes-OATP1B3	Km = 24.7 microM	[8]
Olmesartan medoxomil	Approved	Human embryonic kidney cells (HEK293)-OATP1B3	Km = 44.2 microM	[23]
Olmesartan medoxomil	Approved	Oocytes-OATP1B3	Km = 71.8 microM	[41]
Pitavastatin calcium	Approved	Human embryonic kidney cells (HEK293)-OATP1B3	Km = 3.25 microM	[25]
Pitavastatin calcium	Approved	Oocytes-OATP1B3	Km = 3.8 microM	[42]
Rifampin	Approved	Oocytes-OATP1B3	Km = 2.3 microM	[27]
Rosuvastatin	Approved	Human cervical cancer cell line (Hela)-OATP1B3	Km = 9.8 microM	[43]
Rosuvastatin	Approved	Human embryonic kidney cells (HEK293)-OATP1B3	Km = 14.2 microM	[29]
Telmisartan	Approved	Human embryonic kidney cells (HEK293)-OATP1B3	Km = 0.81 microM	[31]
Telmisartan	Approved	Human embryonic kidney cells (HEK293)-OATP1B3	Km = 3.4 microM	[44]
Valsartan	Approved	Chinese hamster ovary (CHO) cells-OATP1B3	Km = 23.5 microM	[45]
Valsartan	Approved	Human embryonic kidney cells (HEK293)-OATP1B3	Km = 18.2 microM	[33]

Clinical Trial Drug(s)

Drug Name	Highest Status	Cell Line	Affinity	REF
Sodium taurocholate	Phase 1/2	Oocytes-OATP1B3	Km = 5.8 microM	[8]

Investigative Drug(s)

Drug Name	Highest Status	Cell Line	Affinity	REF
Amanitin	Investigative	Madin-Darby canine kidney cells (MDCKII)-OATP1B3	Km = 3.7 microM	[36]
Bilirubin	Investigative	Human embryonic kidney cells (HEK293)-OATP1B3	Km = 0.5 microM	[46]
Bilirubin	Investigative	Oocytes-OATP1B3	Km = 0.0391 microM	[37]
Bromsulphthalein	Investigative	Human embryonic kidney cells (HEK293)-OATP1B3	Km = 3.3 microM	[46]
Bromsulphthalein	Investigative	Oocytes-OATP1B3	Km = 0.4 microM	[2]
CCK-8	Investigative	Oocytes-OATP1B3	Km = 11.1 microM	[47]
[3H]estradiol-17beta-glucuronide	Investigative	Chinese hamster ovary (CHO) cells-OATP1B3	Km = 15.8 microM	[13]
[3H]estradiol-17beta-glucuronide	Investigative	Human embryonic kidney cells (HEK293)-OATP1B3	Km = 24.6 microM	[25]

The Drug Therapeutic Target (DTT) Role of This DTP

• DTP DTT Name: Liver organic anion transporter 2 (SLCO1B3) DTT Info
• DTP DTT Type: Literature-reported

1 Investigative Drug(s) Targeting This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
[3H]estradiol-17beta-glucuronide	DM3KJ45	Discovery agent	N.A.	Investigative	[1]

References

• [1] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1221).
• [2] Organic anion-transporting polypeptide B (OATP-B) and its functional comparison with three other OATPs of human liver. Gastroenterology. 2001 Feb;120(2):525-33.
• [3] FDA Drug Development and Drug Interactions
• [4] Bosentan is a substrate of human OATP1B1 and OATP1B3: inhibition of hepatic uptake as the common mechanism of its interactions with cyclosporin A, rifampicin, and sildenafil. Drug Metab Dispos. 2007 Aug;35(8):1400-7.
• [5] Screening of antibiotics that interact with organic anion-transporting polypeptides 1B1 and 1B3 using fluorescent probes. Biol Pharm Bull. 2011;34(3):389-95.
• [6] Organic Anion-Transporting Polypeptide and Efflux Transporter-Mediated Hepatic Uptake and Biliary Excretion of Cilostazol and Its Metabolites in Rats and Humans. J Pharm Sci. 2017 Sep;106(9):2515-2523.
• [7] Contribution of OATP1B1 and OATP1B3 to the disposition of sorafenib and sorafenib-glucuronide. Clin Cancer Res. 2013 Mar 15;19(6):1458-66.
• [8] LST-2, a human liver-specific organic anion transporter, determines methotrexate sensitivity in gastrointestinal cancers. Gastroenterology. 2001 Jun;120(7):1689-99.
• [9] Influence of non-steroidal anti-inflammatory drugs on organic anion transporting polypeptide (OATP) 1B1- and OATP1B3-mediated drug transport. Drug Metab Dispos. 2011 Jun;39(6):1047-53.
• [10] Rapid screening of antineoplastic candidates for the human organic anion transporter OATP1B3 substrates using fluorescent probes. Cancer Lett. 2008 Feb 18;260(1-2):163-9.
• [11] Vectorial transport of enalapril by Oatp1a1/Mrp2 and OATP1B1 and OATP1B3/MRP2 in rat and human livers. J Pharmacol Exp Ther. 2006 Jul;318(1):395-402.
• [12] Impact of OATP transporters on pharmacokinetics. Br J Pharmacol. 2009 Oct;158(3):693-705.
• [13] Effect of pregnane X receptor ligands on transport mediated by human OATP1B1 and OATP1B3. Eur J Pharmacol. 2008 Apr 14;584(1):57-65.
• [14] Contribution of OATP (organic anion-transporting polypeptide) family transporters to the hepatic uptake of fexofenadine in humans. Drug Metab Dispos. 2005 Oct;33(10):1477-81.
• [15] Development of a cell-based high-throughput assay to screen for inhibitors of organic anion transporting polypeptides 1B1 and 1B3. Curr Chem Genomics. 2010 Mar 1;4:1-8.
• [16] Substrate-dependent drug-drug interactions between gemfibrozil, fluvastatin and other organic anion-transporting peptide (OATP) substrates on OATP1B1, OATP2B1, and OATP1B3. Drug Metab Dispos. 2007 Aug;35(8):1308-14.
• [17] Liver Perfusion Modifies Gd-DTPA and Gd-BOPTA Hepatocyte Concentrations Through Transfer Clearances Across Sinusoidal Membranes. Eur J Drug Metab Pharmacokinet. 2017 Aug;42(4):657-667.
• [18] Regulation of Organic Anion Transporting Polypeptides (OATP) 1B1- and OATP1B3-Mediated Transport: An Updated Review in the Context of OATP-Mediated Drug-Drug Interactions. Int J Mol Sci. 2018 Mar 14;19(3). pii: E855.
• [19] Transcellular movement of hydroxyurea is mediated by specific solute carrier transporters. Exp Hematol. 2011 Apr;39(4):446-56.
• [20] Primovist, Eovist: what to expect? J Hepatol. 2012 Aug;57(2):421-9.
• [21] Role of organic anion-transporting polypeptides for cellular mesalazine (5-aminosalicylic acid) uptake. Drug Metab Dispos. 2011 Jun;39(6):1097-102.
• [22] Influence of SLCO1B1, 1B3, 2B1 and ABCC2 genetic polymorphisms on mycophenolic acid pharmacokinetics in Japanese renal transplant recipients. Eur J Clin Pharmacol. 2007 Dec;63(12):1161-9.
• [23] Multiple human isoforms of drug transporters contribute to the hepatic and renal transport of olmesartan, a selective antagonist of the angiotensin II AT1-receptor. Drug Metab Dispos. 2007 Dec;35(12):2166-76.
• [24] Identification of OATP1B3 as a high-affinity hepatocellular transporter of paclitaxel. Cancer Biol Ther. 2005 Aug;4(8):815-8.
• [25] Contribution of OATP2 (OATP1B1) and OATP8 (OATP1B3) to the hepatic uptake of pitavastatin in humans. J Pharmacol Exp Ther. 2004 Oct;311(1):139-46.
• [26] Relevance of conserved lysine and arginine residues in transmembrane helices for the transport activity of organic anion transporting polypeptide 1B3. Br J Pharmacol. 2010 Feb 1;159(3):698-708.
• [27] Interactions of rifamycin SV and rifampicin with organic anion uptake systems of human liver. Hepatology. 2002 Jul;36(1):164-72.
• [28] Population pharmacokinetics of romidepsin in patients with cutaneous T-cell lymphoma and relapsed peripheral T-cell lymphoma. Clin Cancer Res. 2009 Feb 15;15(4):1496-503.
• [29] Involvement of multiple transporters in the hepatobiliary transport of rosuvastatin. Drug Metab Dispos. 2008 Oct;36(10):2014-23.
• [30] Transporters involved in the hepatic uptake of (99m)Tc-mebrofenin and indocyanine green. J Hepatol. 2011 Apr;54(4):738-45.
• [31] Predominant contribution of OATP1B3 to the hepatic uptake of telmisartan, an angiotensin II receptor antagonist, in humans. Drug Metab Dispos. 2006 Jul;34(7):1109-15.
• [32] Effect of SLCO1B3 haplotype on testosterone transport and clinical outcome in caucasian patients with androgen-independent prostatic cancer. Clin Cancer Res. 2008 Jun 1;14(11):3312-8.
• [33] Involvement of transporters in the hepatic uptake and biliary excretion of valsartan, a selective antagonist of the angiotensin II AT1-receptor, in humans. Drug Metab Dispos. 2006 Jul;34(7):1247-54.
• [34] Hepatic uptake of the magnetic resonance imaging contrast agent Gd-EOB-DTPA: role of human organic anion transporters. Drug Metab Dispos. 2010 Jul;38(7):1024-8.
• [35] Organic anion transporting polypeptide 1B1 activity classified by SLCO1B1 genotype influences atrasentan pharmacokinetics. Clin Pharmacol Ther. 2006 Mar;79(3):186-96.
• [36] Molecular characterization and inhibition of amanitin uptake into human hepatocytes. Toxicol Sci. 2006 May;91(1):140-9.
• [37] Role of organic anion-transporting polypeptides, OATP-A, OATP-C and OATP-8, in the human placenta-maternal liver tandem excretory pathway for foetal bilirubin. Biochem J. 2003 May 1;371(Pt 3):897-905.
• [38] Classification of inhibitors of hepatic organic anion transporting polypeptides (OATPs): influence of protein expression on drug-drug interactions. J Med Chem. 2012 May 24;55(10):4740-63.
• [39] Interactions of green tea catechins with organic anion-transporting polypeptides. Drug Metab Dispos. 2011 May;39(5):920-6.
• [40] Human hepatobiliary transport of organic anions analyzed by quadruple-transfected cells. Mol Pharmacol. 2005 Oct;68(4):1031-8.
• [41] OATP1B1, OATP1B3, and mrp2 are involved in hepatobiliary transport of olmesartan, a novel angiotensin II blocker. Drug Metab Dispos. 2006 May;34(5):862-9.
• [42] Transporter-mediated influx and efflux mechanisms of pitavastatin, a new inhibitor of HMG-CoA reductase. J Pharm Pharmacol. 2005 Oct;57(10):1305-11.
• [43] Drug and bile acid transporters in rosuvastatin hepatic uptake: function, expression, and pharmacogenetics. Gastroenterology. 2006 May;130(6):1793-806.
• [44] Establishment of a set of double transfectants coexpressing organic anion transporting polypeptide 1B3 and hepatic efflux transporters for the characterization of the hepatobiliary transport of telmisartan acylglucuronide. Drug Metab Dispos. 2008 Apr;36(4):796-805.
• [45] Prediction of pharmacokinetic profile of valsartan in human based on in vitro uptake transport data. J Pharmacokinet Pharmacodyn. 2009 Dec;36(6):585-611.
• [46] Hepatic uptake of bilirubin and its conjugates by the human organic anion transporter SLC21A6. J Biol Chem. 2001 Mar 30;276(13):9626-30.
• [47] Hepatic uptake of cholecystokinin octapeptide by organic anion-transporting polypeptides OATP4 and OATP8 of rat and human liver. Gastroenterology. 2001 Nov;121(5):1185-90.