General Information of Drug Off-Target (DOT) (ID: OTA675TJ)

DOT Name Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1)
Synonyms Glucose transporter type 1, erythrocyte/brain; GLUT-1; HepG2 glucose transporter
Gene Name SLC2A1
Related Disease
Childhood onset GLUT1 deficiency syndrome 2 ( )
Encephalopathy due to GLUT1 deficiency ( )
GLUT1 deficiency syndrome ( )
Dystonia 9 ( )
Epilepsy, idiopathic generalized, susceptibility to, 12 ( )
Absence seizure ( )
Hereditary cryohydrocytosis with reduced stomatin ( )
Myoclonic-astatic epilepsy ( )
UniProt ID
GTR1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
4PYP; 5EQG; 5EQH; 5EQI; 6THA
Pfam ID
PF00083
Sequence
MEPSSKKLTGRLMLAVGGAVLGSLQFGYNTGVINAPQKVIEEFYNQTWVHRYGESILPTT
LTTLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAVLMGFSKLGKSFE
MLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSIM
GNKDLWPLLLSIIFIPALLQCIVLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTHD
LQEMKEESRQMMREKKVTILELFRSPAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEK
AGVQQPVYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAILMTIALALLEQ
LPWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGM
CFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPE
ELFHPLGADSQV
Function
Facilitative glucose transporter, which is responsible for constitutive or basal glucose uptake. Has a very broad substrate specificity; can transport a wide range of aldoses including both pentoses and hexoses. Most important energy carrier of the brain: present at the blood-brain barrier and assures the energy-independent, facilitative transport of glucose into the brain. In association with BSG and NXNL1, promotes retinal cone survival by increasing glucose uptake into photoreceptors. Required for mesendoderm differentiation.
Tissue Specificity Detected in erythrocytes (at protein level). Expressed at variable levels in many human tissues.
KEGG Pathway
HIF-1 sig.ling pathway (hsa04066 )
Efferocytosis (hsa04148 )
Insulin secretion (hsa04911 )
Thyroid hormone sig.ling pathway (hsa04919 )
Adipocytokine sig.ling pathway (hsa04920 )
Glucagon sig.ling pathway (hsa04922 )
Insulin resistance (hsa04931 )
Bile secretion (hsa04976 )
Human T-cell leukemia virus 1 infection (hsa05166 )
Pathways in cancer (hsa05200 )
Re.l cell carcinoma (hsa05211 )
Central carbon metabolism in cancer (hsa05230 )
Diabetic cardiomyopathy (hsa05415 )
Reactome Pathway
Vitamin C (ascorbate) metabolism (R-HSA-196836 )
Regulation of insulin secretion (R-HSA-422356 )
Defective SLC2A1 causes GLUT1 deficiency syndrome 1 (GLUT1DS1) (R-HSA-5619043 )
Lactose synthesis (R-HSA-5653890 )
Cellular hexose transport (R-HSA-189200 )
BioCyc Pathway
MetaCyc:ENSG00000117394-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

8 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Childhood onset GLUT1 deficiency syndrome 2 DISXPRXM Definitive Autosomal dominant [1]
Encephalopathy due to GLUT1 deficiency DISFX0JQ Definitive Autosomal dominant [2]
GLUT1 deficiency syndrome DIS8OXEB Definitive Autosomal dominant [3]
Dystonia 9 DIS0KL38 Strong Autosomal dominant [4]
Epilepsy, idiopathic generalized, susceptibility to, 12 DIS90R1X Strong Autosomal dominant [5]
Absence seizure DIS4709R Supportive Autosomal dominant [6]
Hereditary cryohydrocytosis with reduced stomatin DISYP8Y8 Supportive Autosomal dominant [7]
Myoclonic-astatic epilepsy DISTAVMU Supportive Unknown [8]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 3 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Captopril DM458UM Approved Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1) increases the Adverse drug reaction ADR of Captopril. [76]
Dacarbazine DMNPZL4 Approved Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1) decreases the response to substance of Dacarbazine. [78]
Apaziquone DMVY0BU Phase 3 Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1) decreases the response to substance of Apaziquone. [78]
------------------------------------------------------------------------------------
This DOT Affected the Regulation of Drug Effects of 2 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
2-deoxyglucose DMIAHVU Approved Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1) increases the uptake of 2-deoxyglucose. [77]
Dehydroascorbic acid DMKYQO4 Investigative Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1) decreases the transport of Dehydroascorbic acid. [79]
------------------------------------------------------------------------------------
80 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [9]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [10]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [11]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [12]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate affects the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [13]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [14]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [15]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [16]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [17]
Temozolomide DMKECZD Approved Temozolomide increases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [18]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [19]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide decreases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [20]
Vorinostat DMWMPD4 Approved Vorinostat decreases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [21]
Triclosan DMZUR4N Approved Triclosan increases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [22]
Marinol DM70IK5 Approved Marinol decreases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [23]
Phenobarbital DMXZOCG Approved Phenobarbital decreases the activity of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [24]
Progesterone DMUY35B Approved Progesterone increases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [25]
Menadione DMSJDTY Approved Menadione affects the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [26]
Fluorouracil DMUM7HZ Approved Fluorouracil decreases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [27]
Niclosamide DMJAGXQ Approved Niclosamide decreases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [28]
Cannabidiol DM0659E Approved Cannabidiol decreases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [29]
Troglitazone DM3VFPD Approved Troglitazone decreases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [30]
Diethylstilbestrol DMN3UXQ Approved Diethylstilbestrol decreases the activity of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [31]
Rosiglitazone DMILWZR Approved Rosiglitazone decreases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [32]
Cytarabine DMZD5QR Approved Cytarabine decreases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [33]
Cidofovir DMA13GD Approved Cidofovir increases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [34]
Zidovudine DM4KI7O Approved Zidovudine decreases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [35]
Ifosfamide DMCT3I8 Approved Ifosfamide increases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [34]
Ibuprofen DM8VCBE Approved Ibuprofen increases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [34]
Benzatropine DMF7EXL Approved Benzatropine decreases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [29]
Liothyronine DM6IR3P Approved Liothyronine increases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [36]
Imatinib DM7RJXL Approved Imatinib decreases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [37]
Propofol DMB4OLE Approved Propofol decreases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [39]
Sevoflurane DMC9O43 Approved Sevoflurane increases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [39]
Ciprofloxacin XR DM2NLS9 Approved Ciprofloxacin XR decreases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [40]
Mebendazole DMO14SG Approved Mebendazole decreases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [41]
Aluminium DM6ECN9 Approved Aluminium increases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [42]
Ofloxacin DM0VQN3 Approved Ofloxacin decreases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [40]
Pentobarbital DMFNH7L Approved Pentobarbital decreases the activity of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [24]
Glycine DMIOZ29 Approved Glycine decreases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [43]
Cyclofenil DMT5RMB Approved Cyclofenil decreases the activity of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [31]
Dihydrotestosterone DM3S8XC Phase 4 Dihydrotestosterone increases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [44]
Curcumin DMQPH29 Phase 3 Curcumin decreases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [46]
Coprexa DMA0WEK Phase 3 Coprexa decreases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [47]
Acadesine DM1RMF5 Phase 3 Acadesine increases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [48]
FG-4592 DM4XSQ2 Phase 3 FG-4592 increases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [49]
Genistein DM0JETC Phase 2/3 Genistein decreases the activity of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [31]
Amiodarone DMUTEX3 Phase 2/3 Trial Amiodarone decreases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [50]
GDC0941 DM1YAK6 Phase 2 GDC0941 decreases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [51]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [53]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide increases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [54]
LY294002 DMY1AFS Phase 1 LY294002 decreases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [55]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [56]
PMID26394986-Compound-22 DM43Z1G Patented PMID26394986-Compound-22 increases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [58]
MG-132 DMKA2YS Preclinical MG-132 increases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [59]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [60]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [61]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [62]
chloropicrin DMSGBQA Investigative chloropicrin decreases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [63]
Deguelin DMXT7WG Investigative Deguelin increases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [64]
3R14S-OCHRATOXIN A DM2KEW6 Investigative 3R14S-OCHRATOXIN A increases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [65]
Glyphosate DM0AFY7 Investigative Glyphosate increases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [43]
Nickel chloride DMI12Y8 Investigative Nickel chloride increases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [49]
D-glucose DMMG2TO Investigative D-glucose increases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [48]
Phencyclidine DMQBEYX Investigative Phencyclidine increases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [66]
Okadaic acid DM47CO1 Investigative Okadaic acid increases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [67]
CH-223191 DMMJZYC Investigative CH-223191 increases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [68]
PP-242 DM2348V Investigative PP-242 decreases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [69]
Kaempferol DMHEMUB Investigative Kaempferol decreases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [70]
Daidzein DMRFTJX Investigative Daidzein decreases the activity of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [31]
Apigenin DMI3491 Investigative Apigenin decreases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [71]
Myricetin DMTV4L0 Investigative Myricetin decreases the activity of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [31]
Protoporphyrin IX DMWYE7A Investigative Protoporphyrin IX decreases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [72]
Alpha-naphthoflavone DMELOIQ Investigative Alpha-naphthoflavone increases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [68]
DZNep DM0JXBK Investigative DZNep decreases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [73]
Phloretin DMYA50U Investigative Phloretin decreases the activity of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [31]
GW-788388 DMIBUW5 Investigative GW-788388 decreases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [50]
EPZ015666 DM3INX7 Investigative EPZ015666 decreases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [74]
NSC-94258 DM6VY3P Investigative NSC-94258 decreases the activity of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [31]
KAEMPFERIDE DMUWA2G Investigative KAEMPFERIDE decreases the expression of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [75]
------------------------------------------------------------------------------------
⏷ Show the Full List of 80 Drug(s)
3 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT
Drug Name Drug ID Highest Status Interaction REF
Adenosine triphosphate DM79F6G Approved Adenosine triphosphate decreases the stability of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [38]
Resveratrol DM3RWXL Phase 3 Resveratrol affects the binding of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [45]
Preverex DMZT8FS Phase 2 Preverex affects the folding of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [52]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1). [57]
------------------------------------------------------------------------------------

References

1 Paroxysmal exercise-induced dyskinesia and epilepsy is due to mutations in SLC2A1, encoding the glucose transporter GLUT1. Brain. 2008 Jul;131(Pt 7):1831-44. doi: 10.1093/brain/awn113. Epub 2008 Jun 24.
2 Defective glucose transport across the blood-brain barrier as a cause of persistent hypoglycorrhachia, seizures, and developmental delay. N Engl J Med. 1991 Sep 5;325(10):703-9. doi: 10.1056/NEJM199109053251006.
3 Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
4 The Gene Curation Coalition: A global effort to harmonize gene-disease evidence resources. Genet Med. 2022 Aug;24(8):1732-1742. doi: 10.1016/j.gim.2022.04.017. Epub 2022 May 4.
5 From splitting GLUT1 deficiency syndromes to overlapping phenotypes. Eur J Med Genet. 2015 Sep;58(9):443-54. doi: 10.1016/j.ejmg.2015.06.007. Epub 2015 Jul 17.
6 Early-onset absence epilepsy caused by mutations in the glucose transporter GLUT1. Ann Neurol. 2009 Sep;66(3):415-9. doi: 10.1002/ana.21724.
7 Stomatin-deficient cryohydrocytosis results from mutations in SLC2A1: a novel form of GLUT1 deficiency syndrome. Blood. 2011 Nov 10;118(19):5267-77. doi: 10.1182/blood-2010-12-326645. Epub 2011 Jul 26.
8 Glucose transporter 1 deficiency as a treatable cause of myoclonic astatic epilepsy. Arch Neurol. 2011 Sep;68(9):1152-5. doi: 10.1001/archneurol.2011.102. Epub 2011 May 9.
9 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
10 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
11 Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
12 Anthracycline inhibits recruitment of hypoxia-inducible transcription factors and suppresses tumor cell migration and cardiac angiogenic response in the host. J Biol Chem. 2012 Oct 12;287(42):34866-34882. doi: 10.1074/jbc.M112.374587. Epub 2012 Aug 20.
13 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
14 Hypoxia-Induced Cisplatin Resistance in Non-Small Cell Lung Cancer Cells Is Mediated by HIF-1 and Mutant p53 and Can Be Overcome by Induction of Oxidative Stress. Cancers (Basel). 2018 Apr 21;10(4):126. doi: 10.3390/cancers10040126.
15 Identification of estrogen-responsive genes by complementary deoxyribonucleic acid microarray and characterization of a novel early estrogen-induced gene: EEIG1. Mol Endocrinol. 2004 Feb;18(2):402-11. doi: 10.1210/me.2003-0202. Epub 2003 Nov 6.
16 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
17 Multifaceted preventive effects of single agent quercetin on a human prostate adenocarcinoma cell line (PC-3): implications for nutritional transcriptomics and multi-target therapy. Med Oncol. 2011 Dec;28(4):1395-404. doi: 10.1007/s12032-010-9603-3. Epub 2010 Jul 2.
18 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
19 Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
20 Minimal peroxide exposure of neuronal cells induces multifaceted adaptive responses. PLoS One. 2010 Dec 17;5(12):e14352. doi: 10.1371/journal.pone.0014352.
21 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
22 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
23 9-tetrahydrocannabinol exposure during rat pregnancy leads to symmetrical fetal growth restriction and labyrinth-specific vascular defects in the placenta. Sci Rep. 2020 Jan 17;10(1):544. doi: 10.1038/s41598-019-57318-6.
24 GLUT1-deficiency: barbiturates potentiate haploinsufficiency in vitro. Pediatr Res. 1999 Dec;46(6):677-83. doi: 10.1203/00006450-199912000-00006.
25 Differential regulation of glucose transporter expression by estrogen and progesterone in Ishikawa endometrial cancer cells. J Endocrinol. 2004 Sep;182(3):467-78. doi: 10.1677/joe.0.1820467.
26 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
27 Regulation of human peptide transporter 1 (PEPT1) in gastric cancer cells by anticancer drugs. Cancer Lett. 2005 Dec 8;230(1):72-80.
28 Growth inhibition of ovarian tumor-initiating cells by niclosamide. Mol Cancer Ther. 2012 Aug;11(8):1703-12.
29 Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
30 Effects of troglitazone on cellular differentiation, insulin signaling, and glucose metabolism in cultured human skeletal muscle cells. Biochem Biophys Res Commun. 2001 Jan 26;280(3):664-74. doi: 10.1006/bbrc.2000.4216.
31 The inhibitory effects of flavonoids and antiestrogens on the Glut1 glucose transporter in human erythrocytes. Chem Biol Interact. 2003 Dec 15;146(3):225-35. doi: 10.1016/j.cbi.2003.06.001.
32 Effects of chronic rosiglitazone therapy on gene expression in human adipose tissue in vivo in patients with type 2 diabetes. J Clin Endocrinol Metab. 2007 Feb;92(2):720-4.
33 Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
34 Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
35 Differential gene expression in human hepatocyte cell lines exposed to the antiretroviral agent zidovudine. Arch Toxicol. 2014 Mar;88(3):609-23. doi: 10.1007/s00204-013-1169-3. Epub 2013 Nov 30.
36 Thyroid hormone responsive genes in cultured human fibroblasts. J Clin Endocrinol Metab. 2005 Feb;90(2):936-43.
37 AMP-activated protein kinase activation primes cytoplasmic translocation and autophagic degradation of the BCR-ABL protein in CML cells. Cancer Sci. 2021 Jan;112(1):194-204. doi: 10.1111/cas.14698. Epub 2020 Nov 16.
38 Ligand-modulation of the stability of the glucose transporter GLUT 1. Protein Sci. 2001 Jul;10(7):1363-9. doi: 10.1110/ps.48601.
39 Sevoflurane but not propofol enhances ovarian cancer cell biology through regulating cellular metabolic and signaling mechanisms. Cell Biol Toxicol. 2023 Aug;39(4):1395-1411. doi: 10.1007/s10565-022-09766-6. Epub 2022 Oct 8.
40 Disturbance of cellular glucose transport by two prevalently used fluoroquinolone antibiotics ciprofloxacin and levofloxacin involves glucose transporter type 1. Toxicol Lett. 2009 Jan 30;184(2):81-4. doi: 10.1016/j.toxlet.2008.10.017. Epub 2008 Oct 28.
41 Mebendazole targets essential proteins in glucose metabolism leading gastric cancer cells to death. Toxicol Appl Pharmacol. 2023 Sep 15;475:116630. doi: 10.1016/j.taap.2023.116630. Epub 2023 Jul 18.
42 Aluminum toxicity triggers the nuclear translocation of HIF-1alpha and promotes anaerobiosis in hepatocytes. Toxicol In Vitro. 2007 Feb;21(1):16-24. doi: 10.1016/j.tiv.2006.07.013. Epub 2006 Aug 5.
43 Effects of glyphosate and aminomethylphosphonic acid on an isogeneic model of the human blood-brain barrier. Toxicol Lett. 2019 Apr;304:39-49. doi: 10.1016/j.toxlet.2018.12.013. Epub 2018 Dec 31.
44 LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
45 Resolution of the direct interaction with and inhibition of the human GLUT1 hexose transporter by resveratrol from its effect on glucose accumulation. Am J Physiol Cell Physiol. 2013 Jul 1;305(1):C90-9. doi: 10.1152/ajpcell.00387.2012. Epub 2013 Apr 24.
46 Inhibition of ATF4-mediated elevation of both autophagy and AKT/mTOR was involved in antitumorigenic activity of curcumin. Food Chem Toxicol. 2023 Mar;173:113609. doi: 10.1016/j.fct.2023.113609. Epub 2023 Jan 12.
47 Copper deprivation enhances the chemosensitivity of pancreatic cancer to rapamycin by mTORC1/2 inhibition. Chem Biol Interact. 2023 Sep 1;382:110546. doi: 10.1016/j.cbi.2023.110546. Epub 2023 Jun 7.
48 Enhanced insulin-stimulated glycogen synthesis in response to insulin, metformin or rosiglitazone is associated with increased mRNA expression of GLUT4 and peroxisomal proliferator activator receptor gamma co-activator 1. Diabetologia. 2005 Jun;48(6):1173-9. doi: 10.1007/s00125-005-1741-3. Epub 2005 Apr 30.
49 Lactate released from human fibroblasts enhances Ni elution from Ni plate. Toxicology. 2021 Apr 15;453:152723. doi: 10.1016/j.tox.2021.152723. Epub 2021 Feb 14.
50 Capturing time-dependent activation of genes and stress-response pathways using transcriptomics in iPSC-derived renal proximal tubule cells. Cell Biol Toxicol. 2023 Aug;39(4):1773-1793. doi: 10.1007/s10565-022-09783-5. Epub 2022 Dec 31.
51 GDC-0941 inhibits metastatic characteristics of thyroid carcinomas by targeting both the phosphoinositide-3 kinase (PI3K) and hypoxia-inducible factor-1 (HIF-1) pathways. J Clin Endocrinol Metab. 2011 Dec;96(12):E1934-43. doi: 10.1210/jc.2011-1426. Epub 2011 Oct 12.
52 Ligand-induced movements of inner transmembrane helices of Glut1 revealed by chemical cross-linking of di-cysteine mutants. PLoS One. 2012;7(2):e31412. doi: 10.1371/journal.pone.0031412. Epub 2012 Feb 20.
53 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
54 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
55 The anti-MDR efficacy of YAN against A549/Taxol cells is associated with its inhibition on glycolysis and is further enhanced by 2-deoxy-d-glucose. Chem Biol Interact. 2022 Feb 25;354:109843. doi: 10.1016/j.cbi.2022.109843. Epub 2022 Feb 2.
56 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
57 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
58 Effects of celecoxib on the expression of osteoprotegerin, energy metabolism and cell viability in cultured human osteoblastic cells. Clin Exp Rheumatol. 2009 Jan-Feb;27(1):99-107.
59 Hypoxic upregulation of glucose transporters in BeWo choriocarcinoma cells is mediated by hypoxia-inducible factor-1. Am J Physiol Cell Physiol. 2007 Jul;293(1):C477-85. doi: 10.1152/ajpcell.00075.2007. Epub 2007 Apr 18.
60 Bisphenol-A impairs insulin action and up-regulates inflammatory pathways in human subcutaneous adipocytes and 3T3-L1 cells. PLoS One. 2013 Dec 9;8(12):e82099. doi: 10.1371/journal.pone.0082099. eCollection 2013.
61 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
62 Myricetin alleviates the formaldehyde-enhanced Warburg effect in tumor cells through inhibition of HIF-1. Toxicol Appl Pharmacol. 2022 Nov 1;454:116246. doi: 10.1016/j.taap.2022.116246. Epub 2022 Sep 16.
63 Molecular targets of chloropicrin in human airway epithelial cells. Toxicol In Vitro. 2017 Aug;42:247-254.
64 Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
65 Ochratoxin A induces reprogramming of glucose metabolism by switching energy metabolism from oxidative phosphorylation to glycolysis in human gastric epithelium GES-1 cells in vitro. Toxicol Lett. 2020 Oct 15;333:232-241. doi: 10.1016/j.toxlet.2020.08.008. Epub 2020 Aug 22.
66 Altered gene expression patterns in MCF-7 cells induced by the urban dust particulate complex mixture standard reference material 1649a. Cancer Res. 2005 Feb 15;65(4):1251-8.
67 Whole genome mRNA transcriptomics analysis reveals different modes of action of the diarrheic shellfish poisons okadaic acid and dinophysis toxin-1 versus azaspiracid-1 in Caco-2 cells. Toxicol In Vitro. 2018 Feb;46:102-112.
68 2,3,7,8-Tetrachlorodibenzo-p-dioxin-mediated production of reactive oxygen species is an essential step in the mechanism of action to accelerate human keratinocyte differentiation. Toxicol Sci. 2013 Mar;132(1):235-49.
69 Marine biogenics in sea spray aerosols interact with the mTOR signaling pathway. Sci Rep. 2019 Jan 24;9(1):675.
70 The chemopreventive effect of the dietary compound kaempferol on the MCF-7 human breast cancer cell line is dependent on inhibition of glucose cellular uptake. Nutr Cancer. 2015;67(3):504-13. doi: 10.1080/01635581.2015.1002625. Epub 2015 Feb 26.
71 The effect of Apigenin on glycometabolism and cell death in an anaplastic thyroid cancer cell line. Toxicol Appl Pharmacol. 2023 Sep 15;475:116626. doi: 10.1016/j.taap.2023.116626. Epub 2023 Jul 10.
72 Structural requirements within protoporphyrin IX in the inhibition of heat shock protein 90. Chem Biol Interact. 2013 Jun 25;204(1):49-57. doi: 10.1016/j.cbi.2013.04.006. Epub 2013 Apr 24.
73 S-adenosylhomocysteine (AdoHcy)-dependent methyltransferase inhibitor DZNep overcomes breast cancer tamoxifen resistance via induction of NSD2 degradation and suppression of NSD2-driven redox homeostasis. Chem Biol Interact. 2020 Feb 1;317:108965. doi: 10.1016/j.cbi.2020.108965. Epub 2020 Jan 28.
74 Selective PRMT5 Inhibitors Suppress Human CD8(+) T Cells by Upregulation of p53 and Impairment of the AKT Pathway Similar to the Tumor Metabolite MTA. Mol Cancer Ther. 2020 Feb;19(2):409-419. doi: 10.1158/1535-7163.MCT-19-0189. Epub 2019 Nov 11.
75 Isolation, identification, and biological evaluation of HIF-1-modulating compounds from Brazilian green propolis. Bioorg Med Chem. 2011 Sep 15;19(18):5392-401. doi: 10.1016/j.bmc.2011.07.060. Epub 2011 Aug 4.
76 ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.
77 Insulin regulation of hexose transport in mouse 3T3-L1 cells expressing the human HepG2 glucose transporter. J Biol Chem. 1990 Nov 25;265(33):20106-16.
78 Glut-1 as a therapeutic target: increased chemoresistance and HIF-1-independent link with cell turnover is revealed through COMPARE analysis and metabolomic studies. Cancer Chemother Pharmacol. 2008 Mar;61(3):377-93. doi: 10.1007/s00280-007-0480-1. Epub 2007 May 23.
79 Autosomal dominant glut-1 deficiency syndrome and familial epilepsy. Ann Neurol. 2001 Oct;50(4):476-85. doi: 10.1002/ana.1222.