Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTC5U0N5)

DOT Name Nuclear receptor subfamily 1 group I member 2 (NR1I2)
Synonyms Orphan nuclear receptor PAR1; Orphan nuclear receptor PXR; Pregnane X receptor; Steroid and xenobiotic receptor; SXR
Gene Name NR1I2
UniProt ID
NR1I2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1ILG ; 1ILH ; 1M13 ; 1NRL ; 1SKX ; 2O9I ; 2QNV ; 3CTB ; 3HVL ; 3R8D ; 4J5W ; 4J5X ; 4NY9 ; 4S0S ; 4S0T ; 4X1F ; 4X1G ; 4XAO ; 4XHD ; 5A86 ; 5X0R ; 6BNS ; 6DUP ; 6HJ2 ; 6HTY ; 6NX1 ; 6P2B ; 6S41 ; 6TFI ; 6XP9 ; 7AX8 ; 7AX9 ; 7AXA ; 7AXB ; 7AXC ; 7AXD ; 7AXE ; 7AXF ; 7AXG ; 7AXH ; 7AXI ; 7AXJ ; 7AXK ; 7AXL ; 7N2A ; 7RIO ; 7RIU ; 7RIV ; 7YFK ; 8E3N ; 8EQZ ; 8FPE ; 8SZV
Pfam ID
PF00104 ; PF00105
Sequence
MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEG
CKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEE
RRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSS
GCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLL
PHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWE
CGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHR
VVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPF
ATPLMQELFGITGS
Function
Nuclear receptor that binds and is activated by variety of endogenous and xenobiotic compounds. Transcription factor that activates the transcription of multiple genes involved in the metabolism and secretion of potentially harmful xenobiotics, drugs and endogenous compounds. Activated by the antibiotic rifampicin and various plant metabolites, such as hyperforin, guggulipid, colupulone, and isoflavones. Response to specific ligands is species-specific. Activated by naturally occurring steroids, such as pregnenolone and progesterone. Binds to a response element in the promoters of the CYP3A4 and ABCB1/MDR1 genes.
Tissue Specificity Expressed in liver, colon and small intestine.
Reactome Pathway
(Name not found )
Nuclear Receptor transcription pathway (R-HSA-383280 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 1 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Bisphenol A DM2ZLD7 Investigative Nuclear receptor subfamily 1 group I member 2 (NR1I2) increases the response to substance of Bisphenol A. [47]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [1]
------------------------------------------------------------------------------------
96 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [2]
Tretinoin DM49DUI Approved Tretinoin increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [3]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [4]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [5]
Cisplatin DMRHGI9 Approved Cisplatin increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [6]
Estradiol DMUNTE3 Approved Estradiol increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [6]
Quercetin DM3NC4M Approved Quercetin increases the expression of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [7]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [8]
Triclosan DMZUR4N Approved Triclosan decreases the expression of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [9]
Carbamazepine DMZOLBI Approved Carbamazepine increases the expression of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [10]
Decitabine DMQL8XJ Approved Decitabine increases the expression of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [11]
Phenobarbital DMXZOCG Approved Phenobarbital increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [12]
Progesterone DMUY35B Approved Progesterone increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [6]
Fulvestrant DM0YZC6 Approved Fulvestrant increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [13]
Dexamethasone DMMWZET Approved Dexamethasone increases the expression of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [14]
Isotretinoin DM4QTBN Approved Isotretinoin increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [3]
Ethanol DMDRQZU Approved Ethanol increases the expression of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [16]
Etoposide DMNH3PG Approved Etoposide increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [3]
Paclitaxel DMLB81S Approved Paclitaxel increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [12]
Diclofenac DMPIHLS Approved Diclofenac increases the expression of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [17]
Permethrin DMZ0Q1G Approved Permethrin increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [18]
Ethinyl estradiol DMODJ40 Approved Ethinyl estradiol increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [19]
Simvastatin DM30SGU Approved Simvastatin increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [20]
Rifampicin DM5DSFZ Approved Rifampicin increases the expression of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [21]
Cyclophosphamide DM4O2Z7 Approved Cyclophosphamide increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [22]
Mifepristone DMGZQEF Approved Mifepristone increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [23]
Ifosfamide DMCT3I8 Approved Ifosfamide increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [22]
Vinblastine DM5TVS3 Approved Vinblastine increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [22]
Clorgyline DMCEUJD Approved Clorgyline increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [3]
Thalidomide DM70BU5 Approved Thalidomide increases the expression of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [24]
Lindane DMB8CNL Approved Lindane increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [25]
Phenytoin DMNOKBV Approved Phenytoin increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [12]
Ursodeoxycholic acid DMCUT21 Approved Ursodeoxycholic acid increases the expression of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [26]
Beta-carotene DM0RXBT Approved Beta-carotene increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [27]
Nefazodone DM4ZS8M Approved Nefazodone decreases the expression of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [28]
Chenodiol DMQ8JIK Approved Chenodiol increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [29]
Docetaxel DMDI269 Approved Docetaxel increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [22]
Cholecalciferol DMGU74E Approved Cholecalciferol increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [13]
Deoxycholic acid DM3GYAL Approved Deoxycholic acid increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [29]
Warfarin DMJYCVW Approved Warfarin decreases the expression of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [30]
Orlistat DMRJSP8 Approved Orlistat increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [31]
Aminoglutethimide DMWFHMZ Approved Aminoglutethimide increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [32]
Atazanavir DMSYRBX Approved Atazanavir decreases the expression of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [28]
Omeprazole DM471KJ Approved Omeprazole increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [25]
Cimetidine DMH61ZB Approved Cimetidine decreases the expression of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [33]
Hesperetin DMKER83 Approved Hesperetin increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [3]
Mitotane DMU1GX0 Approved Mitotane increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [34]
Clotrimazole DMMFCIH Approved Clotrimazole increases the expression of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [35]
Propranolol DM79NTF Approved Propranolol increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [19]
Flutamide DMK0O7U Approved Flutamide increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [22]
Mefenamic acid DMK7HFI Approved Mefenamic acid increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [36]
Budesonide DMJIBAW Approved Budesonide increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [3]
Methoxsalen DME8FZ9 Approved Methoxsalen increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [37]
Lidocaine DML4ZOT Approved Lidocaine increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [3]
Lansoprazole DMXYLQ3 Approved Lansoprazole increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [3]
Cholic acid DM7OKQV Approved Cholic acid increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [29]
Felodipine DMOSW35 Approved Felodipine increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [38]
Miconazole DMPMYE8 Approved Miconazole decreases the expression of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [39]
Fluticasone propionate DMRWLB2 Approved Fluticasone propionate increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [32]
Riluzole DMECBWN Approved Riluzole increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [3]
Glimepiride DM5FSJA Approved Glimepiride increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [3]
Topiramate DM82Z30 Approved Topiramate increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [40]
Isradipine DMA5XGH Approved Isradipine increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [38]
Procaine DM4LSNE Approved Procaine increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [3]
Phenoxybenzamine DM8KSQH Approved Phenoxybenzamine increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [34]
Disopyramide DM5SYZP Approved Disopyramide increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [3]
Itraconazole DMCR1MV Approved Itraconazole increases the expression of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [35]
Metyrapone DMI7FVQ Approved Metyrapone increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [41]
Nimodipine DMQ0RKZ Approved Nimodipine increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [32]
Midazolam DMXOELT Approved Midazolam increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [42]
Thiabendazole DM7YCK3 Approved Thiabendazole increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [3]
Oxybuprocaine DMI0GDH Approved Oxybuprocaine increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [3]
Sulfinpyrazone DMEV954 Approved Sulfinpyrazone increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [12]
Trifluridine DMG2YBD Approved Trifluridine increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [3]
Megestrol DMDH9KX Approved Megestrol increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [32]
Finasteride DMWV3TZ Approved Finasteride increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [32]
Dicloxacillin DM8EU0Z Approved Dicloxacillin increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [3]
Nabumetone DMAT2XH Approved Nabumetone increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [3]
Secobarbital DM14RF5 Approved Secobarbital increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [32]
Tiaprofenic acid DM23D7J Approved Tiaprofenic acid increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [3]
Bromperidol DM24XYQ Approved Bromperidol increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [3]
Metolazone DMB39LO Approved Metolazone increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [3]
Dibucaine DMF9G7L Approved Dibucaine increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [3]
Nafcillin DMN9RPO Approved Nafcillin increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [3]
Sulfamethazine DMRGZ16 Approved Sulfamethazine increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [12]
Rifaximin DMW1TV2 Approved Rifaximin increases the expression of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [44]
Flunisolide DMZSWQC Approved Flunisolide increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [32]
Monobenzone DMVJS2K Approved Monobenzone increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [3]
Vidarabine DM0N85H Approved Vidarabine increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [3]
Etidronic acid DM1XHYJ Approved Etidronic acid increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [3]
Idoxuridine DMDRT0E Approved Idoxuridine increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [3]
Imipenem DMI9FBP Approved Imipenem increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [3]
Isoetharine DMITSEH Approved Isoetharine increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [3]
Nafronyl DMVMQ1L Approved Nafronyl increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [3]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [45]
Berberine DMC5Q8X Phase 4 Berberine increases the activity of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [46]
------------------------------------------------------------------------------------
⏷ Show the Full List of 96 Drug(s)
3 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT
Drug Name Drug ID Highest Status Interaction REF
Rosiglitazone DMILWZR Approved Rosiglitazone affects the localization of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [15]
Pioglitazone DMKJ485 Approved Pioglitazone affects the localization of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [15]
Pimecrolimus DMZLGRB Approved Pimecrolimus affects the binding of Nuclear receptor subfamily 1 group I member 2 (NR1I2). [43]
------------------------------------------------------------------------------------

References

1 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
3 Screening of a chemical library reveals novel PXR-activating pharmacologic compounds. Toxicol Lett. 2015 Jan 5;232(1):193-202. doi: 10.1016/j.toxlet.2014.10.009. Epub 2014 Oct 16.
4 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
5 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6 The pregnane X receptor regulates gene expression in a ligand- and promoter-selective fashion. Mol Endocrinol. 2005 May;19(5):1170-80.
7 Stable cellular models of nuclear receptor PXR for high-throughput evaluation of small molecules. Toxicol In Vitro. 2018 Oct;52:222-234.
8 Establishment of a stable human cell line, HPL-A3, for use in reporter gene assays of cytochrome P450 3A inducers. Biol Pharm Bull. 2012;35(5):677-85. doi: 10.1248/bpb.35.677.
9 Primary Human Hepatocyte Spheroids as Tools to Study the Hepatotoxic Potential of Non-Pharmaceutical Chemicals. Int J Mol Sci. 2021 Oct 12;22(20):11005. doi: 10.3390/ijms222011005.
10 Transcriptional profiling of genes induced in the livers of patients treated with carbamazepine. Clin Pharmacol Ther. 2006 Nov;80(5):440-456.
11 Transporter gene expression in human head and neck squamous cell carcinoma and associated epigenetic regulatory mechanisms. Am J Pathol. 2013 Jan;182(1):234-43. doi: 10.1016/j.ajpath.2012.09.008. Epub 2012 Nov 6.
12 CYP3A4 induction by drugs: correlation between a pregnane X receptor reporter gene assay and CYP3A4 expression in human hepatocytes. Drug Metab Dispos. 2002 Jul;30(7):795-804.
13 Lignans, bacteriocides and organochlorine compounds activate the human pregnane X receptor (PXR). Toxicol Appl Pharmacol. 2005 Dec 1;209(2):123-33. doi: 10.1016/j.taap.2005.03.015.
14 Dexamethasone controls aryl hydrocarbon receptor (AhR)-mediated CYP1A1 and CYP1A2 expression and activity in primary cultures of human hepatocytes. Chem Biol Interact. 2009 May 15;179(2-3):288-96.
15 A comprehensive evaluation of anti-diabetic drugs on nuclear receptor PXR platform. Toxicol In Vitro. 2019 Oct;60:347-358.
16 Prenatal ethanol exposure increases maternal bile acids through placental transport pathway. Toxicology. 2021 Jun 30;458:152848. doi: 10.1016/j.tox.2021.152848. Epub 2021 Jul 2.
17 Species-specific toxicity of diclofenac and troglitazone in primary human and rat hepatocytes. Chem Biol Interact. 2009 Apr 15;179(1):17-24.
18 Identification of new human pregnane X receptor ligands among pesticides using a stable reporter cell system. Toxicol Sci. 2006 Jun;91(2):501-9.
19 Development of a common carp (Cyprinus carpio) pregnane X receptor (cPXR) transactivation reporter assay and its activation by azole fungicides and pharmaceutical chemicals. Toxicol In Vitro. 2017 Jun;41:114-122. doi: 10.1016/j.tiv.2017.02.023. Epub 2017 Mar 1.
20 Identification of HMG-CoA reductase inhibitors as activators for human, mouse and rat constitutive androstane receptor. Drug Metab Dispos. 2005 Jul;33(7):924-9.
21 Transactivation of ABCG2 through a novel cis-element in the distal promoter by constitutive androstane receptor but not pregnane X receptor in human hepatocytes. Arch Biochem Biophys. 2012 Jan 15;517(2):123-30. doi: 10.1016/j.abb.2011.10.014. Epub 2011 Nov 10.
22 PXR-mediated induction of P-glycoprotein by anticancer drugs in a human colon adenocarcinoma-derived cell line. Cancer Chemother Pharmacol. 2010 Sep;66(4):765-71. doi: 10.1007/s00280-009-1221-4. Epub 2009 Dec 30.
23 Improved assays for xenosensor activation based on reverse transfection. Toxicol In Vitro. 2015 Oct;29(7):1759-65. doi: 10.1016/j.tiv.2015.07.011. Epub 2015 Jul 14.
24 Induction of human cytochrome P450 3A enzymes in cultured placental cells by thalidomide and relevance to bioactivation and toxicity. J Toxicol Sci. 2017;42(3):343-348.
25 Environmental contaminants activate human and polar bear (Ursus maritimus) pregnane X receptors (PXR, NR1I2) differently. Toxicol Appl Pharmacol. 2015 Apr 1;284(1):54-64. doi: 10.1016/j.taap.2015.02.001. Epub 2015 Feb 10.
26 Role of vitamin C transporters and biliverdin reductase in the dual pro-oxidant and anti-oxidant effect of biliary compounds on the placental-fetal unit in cholestasis during pregnancy. Toxicol Appl Pharmacol. 2008 Oct 15;232(2):327-36.
27 Induction of PXR-mediated metabolism by beta-carotene. Biochim Biophys Acta. 2005 May 30;1740(2):162-9. doi: 10.1016/j.bbadis.2004.11.013. Epub 2004 Dec 8.
28 Robustness testing and optimization of an adverse outcome pathway on cholestatic liver injury. Arch Toxicol. 2020 Apr;94(4):1151-1172. doi: 10.1007/s00204-020-02691-9. Epub 2020 Mar 10.
29 Acetylated deoxycholic (DCA) and cholic (CA) acids are potent ligands of pregnane X (PXR) receptor. Toxicol Lett. 2017 Jan 4;265:86-96.
30 Warfarin calcifies human aortic valve interstitial cells at high-phosphate conditions via pregnane X receptor. J Bone Miner Metab. 2019 Nov;37(6):944-956. doi: 10.1007/s00774-019-01001-3. Epub 2019 Apr 8.
31 Investigation of Orlistat effects on PXR activation and CYP3A4 expression in primary human hepatocytes and human intestinal LS174T cells. Eur J Pharm Sci. 2010 Oct 9;41(2):276-80. doi: 10.1016/j.ejps.2010.06.019. Epub 2010 Jul 3.
32 Identification and validation of novel human pregnane X receptor activators among prescribed drugs via ligand-based virtual screening. Drug Metab Dispos. 2011 Feb;39(2):337-44. doi: 10.1124/dmd.110.035808. Epub 2010 Nov 10.
33 Expression and inducibility of cytochrome P450s (CYP1A1, 2B6, 2E1, 3A4) in human cord blood CD34(+) stem cell-derived differentiating neuronal cells. Toxicol Sci. 2012 Oct;129(2):392-410.
34 Identification of novel agonists by high-throughput screening and molecular modelling of human constitutive androstane receptor isoform 3. Arch Toxicol. 2019 Aug;93(8):2247-2264. doi: 10.1007/s00204-019-02495-6. Epub 2019 Jul 16.
35 Azole antimycotics differentially affect rifampicin-induced pregnane X receptor-mediated CYP3A4 gene expression. Drug Metab Dispos. 2008 Feb;36(2):339-48.
36 Development of a bioanalytical test battery for water quality monitoring: Fingerprinting identified micropollutants and their contribution to effects in surface water. Water Res. 2017 Oct 15;123:734-750. doi: 10.1016/j.watres.2017.07.016. Epub 2017 Jul 9.
37 Photochemotherapeutic agent 8-methoxypsoralen induces cytochrome P450 3A4 and carboxylesterase HCE2: evidence on an involvement of the pregnane X receptor. Toxicol Sci. 2007 Jan;95(1):13-22.
38 Optical isomers of dihydropyridine calcium channel blockers display enantiospecific effects on the expression and enzyme activities of human xenobiotics-metabolizing cytochromes P450. Toxicol Lett. 2016 Nov 16;262:173-186.
39 Ketoconazole and miconazole are antagonists of the human glucocorticoid receptor: consequences on the expression and function of the constitutive androstane receptor and the pregnane X receptor. Mol Pharmacol. 2006 Jul;70(1):329-39.
40 Dose-dependent induction of cytochrome P450 (CYP) 3A4 and activation of pregnane X receptor by topiramate. Epilepsia. 2003 Dec;44(12):1521-8.
41 In vivo and mechanistic evidence of nuclear receptor CAR induction by artemisinin. Eur J Clin Invest. 2006 Sep;36(9):647-53. doi: 10.1111/j.1365-2362.2006.01700.x.
42 Benzodiazepines medazepam and midazolam are activators of pregnane X receptor and weak inducers of CYP3A4: investigation in primary cultures of human hepatocytes and hepatocarcinoma cell lines. Toxicol Lett. 2010 Mar 15;193(2):183-8.
43 Identification of approved drugs as potent inhibitors of pregnane X receptor activation with differential receptor interaction profiles. Arch Toxicol. 2018 Apr;92(4):1435-1451.
44 Total synthesis and pharmacological characterization of solomonsterol A, a potent marine pregnane-X-receptor agonist endowed with anti-inflammatory activity. J Med Chem. 2011 Jul 14;54(13):4590-9. doi: 10.1021/jm200241s. Epub 2011 Jun 3.
45 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
46 Identification of novel pregnane X receptor activators from traditional Chinese medicines. J Ethnopharmacol. 2011 Jun 14;136(1):137-43. doi: 10.1016/j.jep.2011.04.022. Epub 2011 Apr 16.
47 Perinatal Bisphenol A Exposure Increases Atherosclerosis in Adult Male PXR-Humanized Mice. Endocrinology. 2018 Apr 1;159(4):1595-1608. doi: 10.1210/en.2017-03250.