Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTIX63TX)

DOT Name Insulin-like growth factor-binding protein 3 (IGFBP3)
Synonyms IBP-3; IGF-binding protein 3; IGFBP-3
Gene Name IGFBP3
UniProt ID
IBP3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
7WRQ
Pfam ID
PF00219 ; PF00086
Sequence
MQRARPTLWAAALTLLVLLRGPPVARAGASSAGLGPVVRCEPCDARALAQCAPPPAVCAE
LVREPGCGCCLTCALSEGQPCGIYTERCGSGLRCQPSPDEARPLQALLDGRGLCVNASAV
SRLRAYLLPAPPAPGNASESEEDRSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHA
KDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFLNVLSPRGVHIPNC
DKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHCYSMQSK
Function
IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Also exhibits IGF-independent antiproliferative and apoptotic effects mediated by its receptor TMEM219/IGFBP-3R. Inhibits the positive effect of humanin on insulin sensitivity. Promotes testicular germ cell apoptosis.
Tissue Specificity Expressed by most tissues. Present in plasma.
KEGG Pathway
p53 sig.ling pathway (hsa04115 )
Cellular senescence (hsa04218 )
Growth hormone synthesis, secretion and action (hsa04935 )
Transcriptio.l misregulation in cancer (hsa05202 )
Reactome Pathway
TP53 Regulates Transcription of Death Receptors and Ligands (R-HSA-6803211 )
Post-translational protein phosphorylation (R-HSA-8957275 )
Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) (R-HSA-381426 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 3 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Topotecan DMP6G8T Approved Insulin-like growth factor-binding protein 3 (IGFBP3) affects the response to substance of Topotecan. [58]
Mitoxantrone DMM39BF Approved Insulin-like growth factor-binding protein 3 (IGFBP3) affects the response to substance of Mitoxantrone. [58]
Cyclophosphamide DM4O2Z7 Approved Insulin-like growth factor-binding protein 3 (IGFBP3) affects the response to substance of Cyclophosphamide. [58]
------------------------------------------------------------------------------------
66 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [1]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [2]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [3]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [4]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [5]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [6]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [7]
Arsenic DMTL2Y1 Approved Arsenic decreases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [8]
Quercetin DM3NC4M Approved Quercetin increases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [9]
Temozolomide DMKECZD Approved Temozolomide decreases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [10]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [11]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [12]
Testosterone DM7HUNW Approved Testosterone decreases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [13]
Triclosan DMZUR4N Approved Triclosan increases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [14]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [15]
Methotrexate DM2TEOL Approved Methotrexate increases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [16]
Decitabine DMQL8XJ Approved Decitabine increases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [17]
Marinol DM70IK5 Approved Marinol decreases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [18]
Selenium DM25CGV Approved Selenium increases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [19]
Phenobarbital DMXZOCG Approved Phenobarbital affects the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [20]
Progesterone DMUY35B Approved Progesterone decreases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [21]
Panobinostat DM58WKG Approved Panobinostat decreases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [22]
Dexamethasone DMMWZET Approved Dexamethasone decreases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [24]
Isotretinoin DM4QTBN Approved Isotretinoin increases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [25]
Troglitazone DM3VFPD Approved Troglitazone decreases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [26]
Hydroquinone DM6AVR4 Approved Hydroquinone decreases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [27]
Azathioprine DMMZSXQ Approved Azathioprine increases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [28]
Ethanol DMDRQZU Approved Ethanol increases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [29]
Cytarabine DMZD5QR Approved Cytarabine decreases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [30]
Diclofenac DMPIHLS Approved Diclofenac affects the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [15]
Ethinyl estradiol DMODJ40 Approved Ethinyl estradiol decreases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [31]
Gemcitabine DMSE3I7 Approved Gemcitabine affects the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [32]
Mifepristone DMGZQEF Approved Mifepristone increases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [33]
Alitretinoin DMME8LH Approved Alitretinoin increases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [34]
Thalidomide DM70BU5 Approved Thalidomide affects the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [35]
Bicalutamide DMZMSPF Approved Bicalutamide decreases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [13]
Ampicillin DMHWE7P Approved Ampicillin increases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [36]
Testosterone Undecanoate DMZO10Y Approved Testosterone Undecanoate increases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [37]
Vandetanib DMRICNP Approved Vandetanib increases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [38]
Cenestin DMXQS7K Approved Cenestin decreases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [39]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [40]
Dihydrotestosterone DM3S8XC Phase 4 Dihydrotestosterone decreases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [13]
Isoflavone DM7U58J Phase 4 Isoflavone affects the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [41]
SNDX-275 DMH7W9X Phase 3 SNDX-275 decreases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [22]
Resveratrol DM3RWXL Phase 3 Resveratrol increases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [42]
Tamibarotene DM3G74J Phase 3 Tamibarotene increases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [43]
Curcumin DMQPH29 Phase 3 Curcumin decreases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [44]
Genistein DM0JETC Phase 2/3 Genistein decreases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [7]
GSK2110183 DMZHB37 Phase 2 GSK2110183 decreases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [45]
Afimoxifene DMFORDT Phase 2 Afimoxifene increases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [42]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [46]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [47]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide increases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [48]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [49]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN increases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [50]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [51]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [22]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [52]
Acetaldehyde DMJFKG4 Investigative Acetaldehyde decreases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [53]
Nickel chloride DMI12Y8 Investigative Nickel chloride increases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [54]
Phencyclidine DMQBEYX Investigative Phencyclidine increases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [55]
[3H]methyltrienolone DMTSGOW Investigative [3H]methyltrienolone increases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [12]
OXYQUINOLINE DMZVS9Y Investigative OXYQUINOLINE decreases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [36]
Bilirubin DMI0V4O Investigative Bilirubin decreases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [56]
all-trans-4-oxo-retinoic acid DMM2R1N Investigative all-trans-4-oxo-retinoic acid increases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [3]
Taurine DMVW7N3 Investigative Taurine decreases the expression of Insulin-like growth factor-binding protein 3 (IGFBP3). [57]
------------------------------------------------------------------------------------
⏷ Show the Full List of 66 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Fulvestrant DM0YZC6 Approved Fulvestrant increases the methylation of Insulin-like growth factor-binding protein 3 (IGFBP3). [23]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT
Drug Name Drug ID Highest Status Interaction REF
Prasterone DM67VKL Approved Prasterone decreases the secretion of Insulin-like growth factor-binding protein 3 (IGFBP3). [13]
Flutamide DMK0O7U Approved Flutamide decreases the secretion of Insulin-like growth factor-binding protein 3 (IGFBP3). [13]
------------------------------------------------------------------------------------

References

1 Design principles of concentration-dependent transcriptome deviations in drug-exposed differentiating stem cells. Chem Res Toxicol. 2014 Mar 17;27(3):408-20.
2 Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
3 Retinoic acid and its 4-oxo metabolites are functionally active in human skin cells in vitro. J Invest Dermatol. 2005 Jul;125(1):143-53.
4 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
5 Functional cardiotoxicity assessment of cosmetic compounds using human-induced pluripotent stem cell-derived cardiomyocytes. Arch Toxicol. 2018 Jan;92(1):371-381.
6 Altered ErbB receptor signaling and gene expression in cisplatin-resistant ovarian cancer. Cancer Res. 2005 Aug 1;65(15):6789-800. doi: 10.1158/0008-5472.CAN-04-2684.
7 Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
8 Influence of Iron on Cytotoxicity and Gene Expression Profiles Induced by Arsenic in HepG2 Cells. Int J Environ Res Public Health. 2019 Nov 14;16(22):4484. doi: 10.3390/ijerph16224484.
9 Quercetin regulates insulin like growth factor signaling and induces intrinsic and extrinsic pathway mediated apoptosis in androgen independent prostate cancer cells (PC-3). Mol Cell Biochem. 2010 Nov;344(1-2):173-84. doi: 10.1007/s11010-010-0540-4. Epub 2010 Jul 25.
10 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
11 Curcumin reduces the expression of survivin, leading to enhancement of arsenic trioxide-induced apoptosis in myelodysplastic syndrome and leukemia stem-like cells. Oncol Rep. 2016 Sep;36(3):1233-42. doi: 10.3892/or.2016.4944. Epub 2016 Jul 15.
12 Growth inhibitory concentrations of androgens up-regulate insulin-like growth factor binding protein-3 expression via an androgen response element in LNCaP human prostate cancer cells. Endocrinology. 2006 Oct;147(10):4599-607. doi: 10.1210/en.2006-0560. Epub 2006 Jul 6.
13 DHT and testosterone, but not DHEA or E2, differentially modulate IGF-I, IGFBP-2, and IGFBP-3 in human prostatic stromal cells. Am J Physiol Endocrinol Metab. 2006 May;290(5):E952-60. doi: 10.1152/ajpendo.00451.2005. Epub 2005 Dec 20.
14 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
15 Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
16 Gene expression profiling of rheumatoid arthritis synovial cells treated with antirheumatic drugs. J Biomol Screen. 2007 Apr;12(3):328-40. doi: 10.1177/1087057107299261. Epub 2007 Mar 22.
17 Chemical genomic screening for methylation-silenced genes in gastric cancer cell lines using 5-aza-2'-deoxycytidine treatment and oligonucleotide microarray. Cancer Sci. 2006 Jan;97(1):64-71.
18 THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
19 Selenium is critical for cancer-signaling gene expression but not cell proliferation in human colon Caco-2 cells. Biofactors. 2007;31(3-4):155-64. doi: 10.1002/biof.5520310302.
20 Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
21 Coordinate up-regulation of TMEM97 and cholesterol biosynthesis genes in normal ovarian surface epithelial cells treated with progesterone: implications for pathogenesis of ovarian cancer. BMC Cancer. 2007 Dec 11;7:223.
22 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
23 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
24 Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
25 Gene microarray analysis of human renal cell carcinoma: the effects of HDAC inhibition and retinoid treatment. Cancer Biol Ther. 2008 Oct;7(10):1607-18.
26 Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
27 Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
28 A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
29 Comparison of replicative senescence and stress-induced premature senescence combining differential display and low-density DNA arrays. FEBS Lett. 2005 Jul 4;579(17):3651-9. doi: 10.1016/j.febslet.2005.05.056.
30 Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
31 The genomic response of a human uterine endometrial adenocarcinoma cell line to 17alpha-ethynyl estradiol. Toxicol Sci. 2009 Jan;107(1):40-55.
32 A fine-needle aspirate-based vulnerability assay identifies polo-like kinase 1 as a mediator of gemcitabine resistance in pancreatic cancer. Mol Cancer Ther. 2010 Feb;9(2):311-8. doi: 10.1158/1535-7163.MCT-09-0693. Epub 2010 Jan 26.
33 Mifepristone induced progesterone withdrawal reveals novel regulatory pathways in human endometrium. Mol Hum Reprod. 2007 Sep;13(9):641-54.
34 9-cis retinoic acid induces insulin-like growth factor binding protein-3 through DR-8 retinoic acid responsive elements. Cancer Biol Ther. 2006 Jun;5(6):586-92. doi: 10.4161/cbt.5.6.2658. Epub 2006 Jun 5.
35 Thalidomide downregulates angiogenic genes in bone marrow endothelial cells of patients with active multiple myeloma. J Clin Oncol. 2005 Aug 10;23(23):5334-46. doi: 10.1200/JCO.2005.03.723. Epub 2005 Jun 6.
36 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
37 Levonorgestrel enhances spermatogenesis suppression by testosterone with greater alteration in testicular gene expression in men. Biol Reprod. 2009 Mar;80(3):484-92.
38 ZD6474 inhibits tumor growth and intraperitoneal dissemination in a highly metastatic orthotopic gastric cancer model. Int J Cancer. 2006 Jan 15;118(2):483-9. doi: 10.1002/ijc.21340.
39 Estrogens exert route- and dose-dependent effects on insulin-like growth factor (IGF)-binding protein-3 and the acid-labile subunit of the IGF ternary complex. J Clin Endocrinol Metab. 2000 May;85(5):1918-22. doi: 10.1210/jcem.85.5.6527.
40 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
41 Soy isoflavones alter expression of genes associated with cancer progression, including interleukin-8, in androgen-independent PC-3 human prostate cancer cells. J Nutr. 2006 Jan;136(1):75-82.
42 Gene expression profiles with activation of the estrogen receptor alpha-selective estrogen receptor modulator complex in breast cancer cells expressing wild-type estrogen receptor. Cancer Res. 2002 Aug 1;62(15):4419-26.
43 Involvement of insulin-like growth factor binding protein-3 in the retinoic acid receptor-alpha-mediated inhibition of hepatocellular carcinoma cell proliferation. Cancer Lett. 2000 Apr 3;151(1):63-70. doi: 10.1016/s0304-3835(99)00410-3.
44 Expression profiles of apoptotic genes induced by curcumin in human breast cancer and mammary epithelial cell lines. Anticancer Res. 2005 Sep-Oct;25(5):3293-302.
45 Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
46 Effect of benzo[a]pyrene on proliferation and metastasis of oral squamous cell carcinoma cells: A transcriptome analysis based on RNA-seq. Environ Toxicol. 2022 Nov;37(11):2589-2604. doi: 10.1002/tox.23621. Epub 2022 Jul 23.
47 Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
48 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
49 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
50 Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
51 Comparative Analysis of Transcriptomic Changes including mRNA and microRNA Expression Induced by the Xenoestrogens Zearalenone and Bisphenol A in Human Ovarian Cells. Toxins (Basel). 2023 Feb 9;15(2):140. doi: 10.3390/toxins15020140.
52 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
53 Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
54 Effects of nickel treatment on H3K4 trimethylation and gene expression. PLoS One. 2011 Mar 24;6(3):e17728. doi: 10.1371/journal.pone.0017728.
55 Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.
56 Global changes in gene regulation demonstrate that unconjugated bilirubin is able to upregulate and activate select components of the endoplasmic reticulum stress response pathway. J Biochem Mol Toxicol. 2010 Mar-Apr;24(2):73-88.
57 Taurine-responsive genes related to signal transduction as identified by cDNA microarray analyses of HepG2 cells. J Med Food. 2006 Spring;9(1):33-41. doi: 10.1089/jmf.2006.9.33.
58 Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.