Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0U1D53)

DOT Name DNA-binding protein inhibitor ID-2 (ID2)
Synonyms Class B basic helix-loop-helix protein 26; bHLHb26; Inhibitor of DNA binding 2; Inhibitor of differentiation 2
Gene Name ID2
Related Disease
Congenital heart disease ( )
UniProt ID
ID2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
4AYA
Pfam ID
PF00010
Sequence
MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVS
KMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEF
PSELMSNDSKALCG
Function
Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation. Inhibits skeletal muscle and cardiac myocyte differentiation. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-BMAL1 heterodimer. Restricts the CLOCK and BMAL1 localization to the cytoplasm. Plays a role in both the input and output pathways of the circadian clock: in the input component, is involved in modulating the magnitude of photic entrainment and in the output component, contributes to the regulation of a variety of liver clock-controlled genes involved in lipid metabolism.
Tissue Specificity Highly expressed in early fetal tissues, including those of the central nervous system.
KEGG Pathway
TGF-beta sig.ling pathway (hsa04350 )
Hippo sig.ling pathway (hsa04390 )
Sig.ling pathways regulating pluripotency of stem cells (hsa04550 )
Transcriptio.l misregulation in cancer (hsa05202 )
Reactome Pathway
NGF-stimulated transcription (R-HSA-9031628 )

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Congenital heart disease DISQBA23 Disputed Autosomal dominant [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 1 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Vinblastine DM5TVS3 Approved DNA-binding protein inhibitor ID-2 (ID2) affects the response to substance of Vinblastine. [51]
------------------------------------------------------------------------------------
56 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of DNA-binding protein inhibitor ID-2 (ID2). [2]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of DNA-binding protein inhibitor ID-2 (ID2). [3]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of DNA-binding protein inhibitor ID-2 (ID2). [4]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of DNA-binding protein inhibitor ID-2 (ID2). [5]
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of DNA-binding protein inhibitor ID-2 (ID2). [6]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of DNA-binding protein inhibitor ID-2 (ID2). [7]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of DNA-binding protein inhibitor ID-2 (ID2). [8]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of DNA-binding protein inhibitor ID-2 (ID2). [3]
Arsenic DMTL2Y1 Approved Arsenic decreases the expression of DNA-binding protein inhibitor ID-2 (ID2). [9]
Quercetin DM3NC4M Approved Quercetin affects the expression of DNA-binding protein inhibitor ID-2 (ID2). [10]
Temozolomide DMKECZD Approved Temozolomide decreases the expression of DNA-binding protein inhibitor ID-2 (ID2). [11]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of DNA-binding protein inhibitor ID-2 (ID2). [12]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide increases the expression of DNA-binding protein inhibitor ID-2 (ID2). [13]
Calcitriol DM8ZVJ7 Approved Calcitriol decreases the expression of DNA-binding protein inhibitor ID-2 (ID2). [14]
Decitabine DMQL8XJ Approved Decitabine increases the expression of DNA-binding protein inhibitor ID-2 (ID2). [15]
Marinol DM70IK5 Approved Marinol decreases the expression of DNA-binding protein inhibitor ID-2 (ID2). [16]
Selenium DM25CGV Approved Selenium decreases the expression of DNA-binding protein inhibitor ID-2 (ID2). [17]
Progesterone DMUY35B Approved Progesterone increases the expression of DNA-binding protein inhibitor ID-2 (ID2). [18]
Fluorouracil DMUM7HZ Approved Fluorouracil increases the expression of DNA-binding protein inhibitor ID-2 (ID2). [19]
Dexamethasone DMMWZET Approved Dexamethasone decreases the expression of DNA-binding protein inhibitor ID-2 (ID2). [20]
Demecolcine DMCZQGK Approved Demecolcine increases the expression of DNA-binding protein inhibitor ID-2 (ID2). [21]
Irinotecan DMP6SC2 Approved Irinotecan decreases the expression of DNA-binding protein inhibitor ID-2 (ID2). [22]
Nicotine DMWX5CO Approved Nicotine increases the splicing of DNA-binding protein inhibitor ID-2 (ID2). [23]
Amphotericin B DMTAJQE Approved Amphotericin B decreases the expression of DNA-binding protein inhibitor ID-2 (ID2). [24]
Obeticholic acid DM3Q1SM Approved Obeticholic acid decreases the expression of DNA-binding protein inhibitor ID-2 (ID2). [25]
Cyclophosphamide DM4O2Z7 Approved Cyclophosphamide decreases the expression of DNA-binding protein inhibitor ID-2 (ID2). [26]
Acocantherin DM7JT24 Approved Acocantherin increases the expression of DNA-binding protein inhibitor ID-2 (ID2). [27]
Acetic Acid, Glacial DM4SJ5Y Approved Acetic Acid, Glacial increases the expression of DNA-binding protein inhibitor ID-2 (ID2). [28]
Motexafin gadolinium DMEJKRF Approved Motexafin gadolinium increases the expression of DNA-binding protein inhibitor ID-2 (ID2). [28]
Methimazole DM25FL8 Approved Methimazole increases the expression of DNA-binding protein inhibitor ID-2 (ID2). [29]
Pomalidomide DMTGBAX Approved Pomalidomide increases the expression of DNA-binding protein inhibitor ID-2 (ID2). [30]
Propylthiouracil DM6D7N8 Approved Propylthiouracil increases the expression of DNA-binding protein inhibitor ID-2 (ID2). [29]
Dihydrotestosterone DM3S8XC Phase 4 Dihydrotestosterone increases the expression of DNA-binding protein inhibitor ID-2 (ID2). [31]
Epigallocatechin gallate DMCGWBJ Phase 3 Epigallocatechin gallate decreases the expression of DNA-binding protein inhibitor ID-2 (ID2). [32]
Curcumin DMQPH29 Phase 3 Curcumin decreases the expression of DNA-binding protein inhibitor ID-2 (ID2). [33]
Rigosertib DMOSTXF Phase 3 Rigosertib increases the expression of DNA-binding protein inhibitor ID-2 (ID2). [34]
Amiodarone DMUTEX3 Phase 2/3 Trial Amiodarone increases the expression of DNA-binding protein inhibitor ID-2 (ID2). [29]
Tocopherol DMBIJZ6 Phase 2 Tocopherol decreases the expression of DNA-binding protein inhibitor ID-2 (ID2). [17]
DNCB DMDTVYC Phase 2 DNCB increases the expression of DNA-binding protein inhibitor ID-2 (ID2). [35]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of DNA-binding protein inhibitor ID-2 (ID2). [26]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of DNA-binding protein inhibitor ID-2 (ID2). [36]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide increases the expression of DNA-binding protein inhibitor ID-2 (ID2). [37]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of DNA-binding protein inhibitor ID-2 (ID2). [38]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN increases the expression of DNA-binding protein inhibitor ID-2 (ID2). [40]
Calphostin C DM9X2D0 Terminated Calphostin C increases the expression of DNA-binding protein inhibitor ID-2 (ID2). [41]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of DNA-binding protein inhibitor ID-2 (ID2). [42]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of DNA-binding protein inhibitor ID-2 (ID2). [43]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of DNA-binding protein inhibitor ID-2 (ID2). [44]
Sulforaphane DMQY3L0 Investigative Sulforaphane decreases the expression of DNA-binding protein inhibitor ID-2 (ID2). [45]
3R14S-OCHRATOXIN A DM2KEW6 Investigative 3R14S-OCHRATOXIN A decreases the expression of DNA-binding protein inhibitor ID-2 (ID2). [26]
Glyphosate DM0AFY7 Investigative Glyphosate increases the expression of DNA-binding protein inhibitor ID-2 (ID2). [46]
Manganese DMKT129 Investigative Manganese increases the expression of DNA-binding protein inhibitor ID-2 (ID2). [47]
Butanoic acid DMTAJP7 Investigative Butanoic acid increases the expression of DNA-binding protein inhibitor ID-2 (ID2). [13]
Nitrobenzanthrone DMN6L70 Investigative Nitrobenzanthrone decreases the expression of DNA-binding protein inhibitor ID-2 (ID2). [48]
Linalool DMGZQ5P Investigative Linalool increases the expression of DNA-binding protein inhibitor ID-2 (ID2). [49]
3-aminobenzamide DM7P3IZ Investigative 3-aminobenzamide decreases the expression of DNA-binding protein inhibitor ID-2 (ID2). [50]
------------------------------------------------------------------------------------
⏷ Show the Full List of 56 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of DNA-binding protein inhibitor ID-2 (ID2). [39]
------------------------------------------------------------------------------------

References

1 Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
2 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
4 Id2 gene-targeted crosstalk between Wnt and retinoid signaling regulates proliferation in human keratinocytes. Oncogene. 2007 Aug 2;26(35):5038-45. doi: 10.1038/sj.onc.1210320. Epub 2007 Feb 19.
5 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
6 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
7 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
8 The thioxotriazole copper(II) complex A0 induces endoplasmic reticulum stress and paraptotic death in human cancer cells. J Biol Chem. 2009 Sep 4;284(36):24306-19.
9 Gene expression profiles in peripheral lymphocytes by arsenic exposure and skin lesion status in a Bangladeshi population. Cancer Epidemiol Biomarkers Prev. 2006 Jul;15(7):1367-75. doi: 10.1158/1055-9965.EPI-06-0106.
10 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
11 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
12 Arsenic suppresses gene expression in promyelocytic leukemia cells partly through Sp1 oxidation. Blood. 2005 Jul 1;106(1):304-10.
13 MS4A3-HSP27 target pathway reveals potential for haematopoietic disorder treatment in alimentary toxic aleukia. Cell Biol Toxicol. 2023 Feb;39(1):201-216. doi: 10.1007/s10565-021-09639-4. Epub 2021 Sep 28.
14 Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
15 The DNA methyltransferase inhibitors azacitidine, decitabine and zebularine exert differential effects on cancer gene expression in acute myeloid leukemia cells. Leukemia. 2009 Jun;23(6):1019-28.
16 THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
17 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
18 Gene expression in endometrial cancer cells (Ishikawa) after short time high dose exposure to progesterone. Steroids. 2008 Jan;73(1):116-28.
19 Transcriptional profiling of MCF7 breast cancer cells in response to 5-Fluorouracil: relationship with cell cycle changes and apoptosis, and identification of novel targets of p53. Int J Cancer. 2006 Sep 1;119(5):1164-75.
20 Dickkopf 1 mediates glucocorticoid-induced changes in human neural progenitor cell proliferation and differentiation. Toxicol Sci. 2012 Feb;125(2):488-95. doi: 10.1093/toxsci/kfr304. Epub 2011 Nov 1.
21 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
22 In vitro and in vivo irinotecan-induced changes in expression profiles of cell cycle and apoptosis-associated genes in acute myeloid leukemia cells. Mol Cancer Ther. 2005 Jun;4(6):885-900.
23 Characterizing the genetic basis for nicotine induced cancer development: a transcriptome sequencing study. PLoS One. 2013 Jun 18;8(6):e67252.
24 Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
25 Pharmacotoxicology of clinically-relevant concentrations of obeticholic acid in an organotypic human hepatocyte system. Toxicol In Vitro. 2017 Mar;39:93-103.
26 Transcriptome-based functional classifiers for direct immunotoxicity. Arch Toxicol. 2014 Mar;88(3):673-89.
27 Ouabain impairs cell migration, and invasion and alters gene expression of human osteosarcoma U-2 OS cells. Environ Toxicol. 2017 Nov;32(11):2400-2413. doi: 10.1002/tox.22453. Epub 2017 Aug 10.
28 Motexafin gadolinium and zinc induce oxidative stress responses and apoptosis in B-cell lymphoma lines. Cancer Res. 2005 Dec 15;65(24):11676-88.
29 Monitoring of deiodinase deficiency based on transcriptomic responses in SH-SY5Y cells. Arch Toxicol. 2013 Jun;87(6):1103-13. doi: 10.1007/s00204-013-1018-4. Epub 2013 Feb 10.
30 Immunomodulatory derivative of thalidomide (IMiD CC-4047) induces a shift in lineage commitment by suppressing erythropoiesis and promoting myelopoiesis. Blood. 2005 May 15;105(10):3833-40. doi: 10.1182/blood-2004-03-0828. Epub 2004 Aug 3.
31 Non-redundant inhibitor of differentiation (Id) gene expression and function in human prostate epithelial cells. Prostate. 2006 Jun 15;66(9):921-35. doi: 10.1002/pros.20366.
32 Molecular mechanisms of action of angiopreventive anti-oxidants on endothelial cells: microarray gene expression analyses. Mutat Res. 2005 Dec 11;591(1-2):198-211.
33 Curcumin suppresses growth of mesothelioma cells in vitro and in vivo, in part, by stimulating apoptosis. Mol Cell Biochem. 2011 Nov;357(1-2):83-94. doi: 10.1007/s11010-011-0878-2. Epub 2011 May 19.
34 ON 01910.Na is selectively cytotoxic for chronic lymphocytic leukemia cells through a dual mechanism of action involving PI3K/AKT inhibition and induction of oxidative stress. Clin Cancer Res. 2012 Apr 1;18(7):1979-91. doi: 10.1158/1078-0432.CCR-11-2113. Epub 2012 Feb 20.
35 Upregulation of genes orchestrating keratinocyte differentiation, including the novel marker gene ID2, by contact sensitizers in human bulge-derived keratinocytes. J Biochem Mol Toxicol. 2010 Jan-Feb;24(1):10-20.
36 Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
37 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
38 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
39 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
40 Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
41 Targeting the beta-catenin/TCF transcriptional complex in the treatment of multiple myeloma. Proc Natl Acad Sci U S A. 2007 May 1;104(18):7516-21. doi: 10.1073/pnas.0610299104. Epub 2007 Apr 23.
42 Roles of ERR and TGF- signaling in stemness enhancement induced by 1 ?M bisphenol A exposure via human neural stem cells. Exp Ther Med. 2022 Feb;23(2):164. doi: 10.3892/etm.2021.11087. Epub 2021 Dec 22.
43 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
44 Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
45 Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
46 Glyphosate-based herbicides at low doses affect canonical pathways in estrogen positive and negative breast cancer cell lines. PLoS One. 2019 Jul 11;14(7):e0219610. doi: 10.1371/journal.pone.0219610. eCollection 2019.
47 Gene expression profiling of human primary astrocytes exposed to manganese chloride indicates selective effects on several functions of the cells. Neurotoxicology. 2007 May;28(3):478-89.
48 3-Nitrobenzanthrone promotes malignant transformation in human lung epithelial cells through the epiregulin-signaling pathway. Cell Biol Toxicol. 2022 Oct;38(5):865-887. doi: 10.1007/s10565-021-09612-1. Epub 2021 May 25.
49 Linalool preferentially induces robust apoptosis of a variety of leukemia cells via upregulating p53 and cyclin-dependent kinase inhibitors. Toxicology. 2010 Jan 31;268(1-2):19-24. doi: 10.1016/j.tox.2009.11.013. Epub 2009 Nov 14.
50 Differentiative pathway activated by 3-aminobenzamide, an inhibitor of PARP, in human osteosarcoma MG-63 cells. FEBS Lett. 2005 Jan 31;579(3):615-20. doi: 10.1016/j.febslet.2004.12.028.
51 Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.