Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT1AI9EO)

• DOT Name: Condensin complex subunit 3 (NCAPG)
• Synonyms: Chromosome-associated protein G; Condensin subunit CAP-G; hCAP-G; Melanoma antigen NY-MEL-3; Non-SMC condensin I complex subunit G; XCAP-G homolog
• Gene Name: NCAPG
• Related Disease:
  Adult hepatocellular carcinoma
  Advanced cancer
  Castration-resistant prostate carcinoma
  Liver cancer
  Lung adenocarcinoma
  Melanoma
  Neoplasm
  Triple negative breast cancer
  Gastric cancer
  Stomach cancer
• UniProt ID: CND3_HUMAN
• PDB ID: 6IGX
• Pfam ID: PF12719
• Sequence:
  MGAERRLLSIKEAFRLAQQPHQNQAKLVVALSRTYRTMDDKTVFHEEFIHYLKYVMVVYK
  REPAVERVIEFAAKFVTSFHQSDMEDDEEEEDGGLLNYLFTFLLKSHEANSNAVRFRVCL
  LINKLLGSMPENAQIDDDVFDKINKAMLIRLKDKIPNVRIQAVLALSRLQDPKDDECPVV
  NAYATLIENDSNPEVRRAVLSCIAPSAKTLPKIVGRTKDVKEAVRKLAYQVLAEKVHMRA
  MSIAQRVMLLQQGLNDRSDAVKQAMQKHLLQGWLRFSEGNILELLHRLDVENSSEVAVSV
  LNALFSITPLSELVGLCKNNDGRKLIPVETLTPEIALYWCALCEYLKSKGDEGEEFLEQI
  LPEPVVYADYLLSYIQSIPVVNEEHRGDFSYIGNLMTKEFIGQQLILIIKSLDTSEEGGR
  KKLLAVLQEILILPTIPISLVSFLVERLLHIIIDDNKRTQIVTEIISEIRAPIVTVGVNN
  DPADVRKKELKMAEIKVKLIEAKEALENCITLQDFNRASELKEEIKALEDARINLLKETE
  QLEIKEVHIEKNDAETLQKCLILCYELLKQMSISTGLSATMNGIIESLILPGIISIHPVV
  RNLAVLCLGCCGLQNQDFARKHFVLLLQVLQIDDVTIKISALKAIFDQLMTFGIEPFKTK
  KIKTLHCEGTEINSDDEQESKEVEETATAKNVLKLLSDFLDSEVSELRTGAAEGLAKLMF
  SGLLVSSRILSRLILLWYNPVTEEDVQLRHCLGVFFPVFAYASRTNQECFEEAFLPTLQT
  LANAPASSPLAEIDITNVAELLVDLTRPSGLNPQAKTSQDYQALTVHDNLAMKICNEILT
  SPCSPEIRVYTKALSSLELSSHLAKDLLVLLNEILEQVKDRTCLRALEKIKIQLEKGNKE
  FGDQAEAAQDATLTTTTFQNEDEKNKEVYMTPLRGVKATQASKSTQLKTNRGQRKVTVSA
  RTNRRCQTAEADSESDHEVPEPESEMKMRLPRRAKTAALEKSKLNLAQFLNEDLS
• Function: Regulatory subunit of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases.
• Tissue Specificity: Highly expressed in testis.
• Reactome Pathway: Condensation of Prometaphase Chromosomes (R-HSA-2514853)

Molecular Interaction Atlas (MIA) of This DOT

10 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adult hepatocellular carcinoma	DIS6ZPAI	Strong	Biomarker	[1]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[2]
Castration-resistant prostate carcinoma	DISVGAE6	Strong	Altered Expression	[2]
Liver cancer	DISDE4BI	Strong	Biomarker	[1]
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[3]
Melanoma	DIS1RRCY	Strong	Altered Expression	[4]
Neoplasm	DISZKGEW	Strong	Biomarker	[1]
Triple negative breast cancer	DISAMG6N	Strong	Biomarker	[5]
Gastric cancer	DISXGOUK	Limited	Altered Expression	[6]
Stomach cancer	DISKIJSX	Limited	Altered Expression	[6]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Paclitaxel	DMLB81S	Approved	Condensin complex subunit 3 (NCAPG) affects the response to substance of Paclitaxel.	[38]
Vinblastine	DM5TVS3	Approved	Condensin complex subunit 3 (NCAPG) affects the response to substance of Vinblastine.	[38]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Condensin complex subunit 3 (NCAPG).	[7]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of Condensin complex subunit 3 (NCAPG).	[34]
Coumarin	DM0N8ZM	Investigative	Coumarin decreases the phosphorylation of Condensin complex subunit 3 (NCAPG).	[34]

32 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Condensin complex subunit 3 (NCAPG).	[8]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Condensin complex subunit 3 (NCAPG).	[9]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Condensin complex subunit 3 (NCAPG).	[10]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Condensin complex subunit 3 (NCAPG).	[11]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Condensin complex subunit 3 (NCAPG).	[12]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Condensin complex subunit 3 (NCAPG).	[13]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Condensin complex subunit 3 (NCAPG).	[14]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Condensin complex subunit 3 (NCAPG).	[15]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Condensin complex subunit 3 (NCAPG).	[16]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Condensin complex subunit 3 (NCAPG).	[16]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Condensin complex subunit 3 (NCAPG).	[17]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Condensin complex subunit 3 (NCAPG).	[18]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Condensin complex subunit 3 (NCAPG).	[19]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Condensin complex subunit 3 (NCAPG).	[20]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of Condensin complex subunit 3 (NCAPG).	[21]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of Condensin complex subunit 3 (NCAPG).	[22]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of Condensin complex subunit 3 (NCAPG).	[23]
Clozapine	DMFC71L	Approved	Clozapine increases the expression of Condensin complex subunit 3 (NCAPG).	[24]
Lucanthone	DMZLBUO	Approved	Lucanthone decreases the expression of Condensin complex subunit 3 (NCAPG).	[25]
Palbociclib	DMD7L94	Approved	Palbociclib decreases the expression of Condensin complex subunit 3 (NCAPG).	[26]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Condensin complex subunit 3 (NCAPG).	[27]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Condensin complex subunit 3 (NCAPG).	[13]
GSK2110183	DMZHB37	Phase 2	GSK2110183 decreases the expression of Condensin complex subunit 3 (NCAPG).	[28]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the expression of Condensin complex subunit 3 (NCAPG).	[29]
PEITC	DMOMN31	Phase 2	PEITC decreases the expression of Condensin complex subunit 3 (NCAPG).	[30]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Condensin complex subunit 3 (NCAPG).	[31]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Condensin complex subunit 3 (NCAPG).	[32]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Condensin complex subunit 3 (NCAPG).	[33]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Condensin complex subunit 3 (NCAPG).	[35]
Scriptaid	DM9JZ21	Preclinical	Scriptaid affects the expression of Condensin complex subunit 3 (NCAPG).	[36]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Condensin complex subunit 3 (NCAPG).	[37]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Condensin complex subunit 3 (NCAPG).	[27]

References

• [1] Non-SMC Condensin I Complex, Subunit G (NCAPG) is a Novel Mitotic Gene Required for Hepatocellular Cancer Cell Proliferation and Migration.Oncol Res. 2018 Mar 5;26(2):269-276. doi: 10.3727/096504017X15075967560980. Epub 2017 Oct 18.
• [2] Regulation of NCAPG by miR-99a-3p (passenger strand) inhibits cancer cell aggressiveness and is involved in CRPC.Cancer Med. 2018 May;7(5):1988-2002. doi: 10.1002/cam4.1455. Epub 2018 Apr 2.
• [3] Identification of an eight-gene prognostic signature for lung adenocarcinoma.Cancer Manag Res. 2018 Sep 10;10:3383-3392. doi: 10.2147/CMAR.S173941. eCollection 2018.
• [4] Serological cloning of a melanocyte rab guanosine 5'-triphosphate-binding protein and a chromosome condensation protein from a melanoma complementary DNA library.Cancer Res. 2000 Jul 1;60(13):3584-91.
• [5] Novel key genes in triple-negative breast cancer identified by weighted gene co-expression network analysis.J Cell Biochem. 2019 Oct;120(10):16900-16912. doi: 10.1002/jcb.28948. Epub 2019 May 13.
• [6] Dysregulation of NCAPG, KNL1, miR-148a-3p, miR-193b-3p, and miR-1179 may contribute to the progression of gastric cancer.Biol Res. 2018 Nov 3;51(1):44. doi: 10.1186/s40659-018-0192-5.
• [7] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [8] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [9] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [10] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [11] RNA sequence analysis of inducible pluripotent stem cell-derived cardiomyocytes reveals altered expression of DNA damage and cell cycle genes in response to doxorubicin. Toxicol Appl Pharmacol. 2018 Oct 1;356:44-53.
• [12] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [13] Convergent transcriptional profiles induced by endogenous estrogen and distinct xenoestrogens in breast cancer cells. Carcinogenesis. 2006 Aug;27(8):1567-78.
• [14] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [15] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [16] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [17] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [18] Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
• [19] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [20] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [21] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [22] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [23] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [24] Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
• [25] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [26] Cdk4/6 inhibition induces epithelial-mesenchymal transition and enhances invasiveness in pancreatic cancer cells. Mol Cancer Ther. 2012 Oct;11(10):2138-48. doi: 10.1158/1535-7163.MCT-12-0562. Epub 2012 Aug 6.
• [27] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [28] Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
• [29] Comparison of gene expression profiles in HepG2 cells exposed to arsenic, cadmium, nickel, and three model carcinogens for investigating the mechanisms of metal carcinogenesis. Environ Mol Mutagen. 2009 Jan;50(1):46-59.
• [30] Phenethyl isothiocyanate alters the gene expression and the levels of protein associated with cell cycle regulation in human glioblastoma GBM 8401 cells. Environ Toxicol. 2017 Jan;32(1):176-187.
• [31] Gene expression changes in human prostate carcinoma cells exposed to genotoxic and nongenotoxic aryl hydrocarbon receptor ligands. Toxicol Lett. 2011 Oct 10;206(2):178-88.
• [32] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [33] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [34] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [35] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [36] Histone deacetylase inhibitor scriptaid induces cell cycle arrest and epigenetic change in colon cancer cells. Int J Oncol. 2008 Oct;33(4):767-76.
• [37] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [38] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.