Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2AZPKK)

• DOT Name: Neuronal regeneration-related protein (NREP)
• Synonyms: Neuronal protein 3.1; Protein p311
• Gene Name: NREP
• Related Disease:
  Adult glioblastoma
  Breast carcinoma
  Congenital heart disease
  Fatty liver disease
  Glioblastoma multiforme
  Heart septal defect
  Huntington disease
  Neoplasm
  Renal fibrosis
  Bloom syndrome
  High blood pressure
  Pulmonary emphysema
  Pulmonary fibrosis
  Glioma
• UniProt ID: NREP_HUMAN
• Pfam ID: PF11092
• Sequence:
  MVYYPELFVWVSQEPFPNKDMEGRLPKGRLPVPKEVNRKKNDETNAASLTPLGSSELRSP
  RISYLHFF
• Function: May have roles in neural function. Ectopic expression augments motility of gliomas. Promotes also axonal regeneration. May also have functions in cellular differentiation. Induces differentiation of fibroblast into myofibroblast and myofibroblast ameboid migration. Increases retinoic-acid regulation of lipid-droplet biogenesis. Down-regulates the expression of TGFB1 and TGFB2 but not of TGFB3. May play a role in the regulation of alveolar generation.
• Tissue Specificity: Expressed in lung (at protein level).

Molecular Interaction Atlas (MIA) of This DOT

14 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adult glioblastoma	DISVP4LU	Strong	Altered Expression	[1]
Breast carcinoma	DIS2UE88	Strong	Genetic Variation	[2]
Congenital heart disease	DISQBA23	Strong	Biomarker	[3]
Fatty liver disease	DIS485QZ	Strong	Biomarker	[4]
Glioblastoma multiforme	DISK8246	Strong	Altered Expression	[1]
Heart septal defect	DISQ5C5J	Strong	Biomarker	[3]
Huntington disease	DISQPLA4	Strong	Genetic Variation	[5]
Neoplasm	DISZKGEW	Strong	Altered Expression	[1]
Renal fibrosis	DISMHI3I	Strong	Biomarker	[6]
Bloom syndrome	DISKXQ7J	moderate	Altered Expression	[7]
High blood pressure	DISY2OHH	moderate	Altered Expression	[8]
Pulmonary emphysema	DIS5M7HZ	moderate	Altered Expression	[9]
Pulmonary fibrosis	DISQKVLA	moderate	Biomarker	[7]
Glioma	DIS5RPEH	Limited	Genetic Variation	[10]

34 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Neuronal regeneration-related protein (NREP).	[11]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Neuronal regeneration-related protein (NREP).	[12]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Neuronal regeneration-related protein (NREP).	[13]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Neuronal regeneration-related protein (NREP).	[14]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Neuronal regeneration-related protein (NREP).	[15]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Neuronal regeneration-related protein (NREP).	[16]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Neuronal regeneration-related protein (NREP).	[17]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Neuronal regeneration-related protein (NREP).	[18]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Neuronal regeneration-related protein (NREP).	[19]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Neuronal regeneration-related protein (NREP).	[20]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Neuronal regeneration-related protein (NREP).	[21]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of Neuronal regeneration-related protein (NREP).	[22]
Folic acid	DMEMBJC	Approved	Folic acid affects the expression of Neuronal regeneration-related protein (NREP).	[23]
Demecolcine	DMCZQGK	Approved	Demecolcine decreases the expression of Neuronal regeneration-related protein (NREP).	[24]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone decreases the expression of Neuronal regeneration-related protein (NREP).	[25]
Dasatinib	DMJV2EK	Approved	Dasatinib increases the expression of Neuronal regeneration-related protein (NREP).	[26]
Cidofovir	DMA13GD	Approved	Cidofovir increases the expression of Neuronal regeneration-related protein (NREP).	[25]
Fenofibrate	DMFKXDY	Approved	Fenofibrate decreases the expression of Neuronal regeneration-related protein (NREP).	[25]
Ifosfamide	DMCT3I8	Approved	Ifosfamide affects the expression of Neuronal regeneration-related protein (NREP).	[25]
Clodronate	DM9Y6X7	Approved	Clodronate increases the expression of Neuronal regeneration-related protein (NREP).	[25]
Adefovir dipivoxil	DMMAWY1	Approved	Adefovir dipivoxil decreases the expression of Neuronal regeneration-related protein (NREP).	[25]
Pantothenic acid	DM091H2	Approved	Pantothenic acid increases the expression of Neuronal regeneration-related protein (NREP).	[27]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Neuronal regeneration-related protein (NREP).	[28]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Neuronal regeneration-related protein (NREP).	[29]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Neuronal regeneration-related protein (NREP).	[30]
DNCB	DMDTVYC	Phase 2	DNCB decreases the expression of Neuronal regeneration-related protein (NREP).	[31]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Neuronal regeneration-related protein (NREP).	[32]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Neuronal regeneration-related protein (NREP).	[33]
PMID28870136-Compound-48	DMPIM9L	Patented	PMID28870136-Compound-48 decreases the expression of Neuronal regeneration-related protein (NREP).	[34]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Neuronal regeneration-related protein (NREP).	[35]
Celastrol	DMWQIJX	Preclinical	Celastrol decreases the expression of Neuronal regeneration-related protein (NREP).	[36]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Neuronal regeneration-related protein (NREP).	[37]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Neuronal regeneration-related protein (NREP).	[24]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Neuronal regeneration-related protein (NREP).	[38]

References

• [1] Identification and validation of P311 as a glioblastoma invasion gene using laser capture microdissection.Cancer Res. 2001 May 15;61(10):4190-6.
• [2] Association analysis identifies 65 new breast cancer risk loci.Nature. 2017 Nov 2;551(7678):92-94. doi: 10.1038/nature24284. Epub 2017 Oct 23.
• [3] Analysis of gene copy number variations in patients with congenital heart disease using multiplex ligation-dependent probe amplification.Anatol J Cardiol. 2018 Jul;20(1):9-15. doi: 10.14744/AnatolJCardiol.2018.70481.
• [4] Characterization of chemically induced liver injuries using gene co-expression modules.PLoS One. 2014 Sep 16;9(9):e107230. doi: 10.1371/journal.pone.0107230. eCollection 2014.
• [5] Mapping of D4S98/S114/S113 confines the Huntington's defect to a reduced physical region at the telomere of chromosome 4.Nucleic Acids Res. 1988 Dec 23;16(24):11769-80. doi: 10.1093/nar/16.24.11769.
• [6] Adenovirus-mediated P311 ameliorates renal fibrosis through inhibition of epithelial-mesenchymal transition via TGF-1-Smad-ILK pathway in unilateral ureteral obstruction rats.Int J Mol Med. 2018 May;41(5):3015-3023. doi: 10.3892/ijmm.2018.3485. Epub 2018 Feb 12.
• [7] P311 Promotes Lung Fibrosis via Stimulation of Transforming Growth Factor-1, -2, and -3 Translation.Am J Respir Cell Mol Biol. 2019 Feb;60(2):221-231. doi: 10.1165/rcmb.2018-0028OC.
• [8] Blood pressure homeostasis is maintained by a P311-TGF- axis.J Clin Invest. 2013 Oct;123(10):4502-12. doi: 10.1172/JCI69884. Epub 2013 Sep 16.
• [9] Identification of P311 as a potential gene regulating alveolar generation.Am J Respir Cell Mol Biol. 2006 Jul;35(1):48-54. doi: 10.1165/rcmb.2005-0475OC. Epub 2006 Feb 16.
• [10] Regulation of glioma cell migration by serine-phosphorylated P311.Neoplasia. 2005 Sep;7(9):862-72. doi: 10.1593/neo.05190.
• [11] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [12] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [13] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [14] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [15] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [16] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [17] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [18] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [19] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [20] Changes in gene expression profiles of multiple myeloma cells induced by arsenic trioxide (ATO): possible mechanisms to explain ATO resistance in vivo. Br J Haematol. 2005 Mar;128(5):636-44.
• [21] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [22] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [23] Folate deficiency in normal human fibroblasts leads to altered expression of genes primarily linked to cell signaling, the cytoskeleton and extracellular matrix. J Nutr Biochem. 2007 Aug;18(8):541-52. doi: 10.1016/j.jnutbio.2006.11.002. Epub 2007 Feb 22.
• [24] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [25] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [26] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [27] Calcium pantothenate modulates gene expression in proliferating human dermal fibroblasts. Exp Dermatol. 2009 Nov;18(11):969-78. doi: 10.1111/j.1600-0625.2009.00884.x. Epub 2009 Apr 8.
• [28] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [29] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [30] A high concentration of genistein down-regulates activin A, Smad3 and other TGF-beta pathway genes in human uterine leiomyoma cells. Exp Mol Med. 2012 Apr 30;44(4):281-92.
• [31] Microarray analyses in dendritic cells reveal potential biomarkers for chemical-induced skin sensitization. Mol Immunol. 2007 May;44(12):3222-33.
• [32] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [33] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [34] Oxidative stress modulates theophylline effects on steroid responsiveness. Biochem Biophys Res Commun. 2008 Dec 19;377(3):797-802.
• [35] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [36] Gene expression signature-based chemical genomic prediction identifies a novel class of HSP90 pathway modulators. Cancer Cell. 2006 Oct;10(4):321-30.
• [37] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [38] Sulforaphane-induced apoptosis in human leukemia HL-60 cells through extrinsic and intrinsic signal pathways and altering associated genes expression assayed by cDNA microarray. Environ Toxicol. 2017 Jan;32(1):311-328.