Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2D9DOV)

DOT Name Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A)
Synonyms Tumor necrosis factor receptor 1; TNF-R1; Tumor necrosis factor receptor type I; TNF-RI; TNFR-I; p55; p60; CD antigen CD120a
Gene Name TNFRSF1A
Related Disease
Autosomal dominant familial periodic fever ( )
UniProt ID
TNR1A_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1EXT; 1FT4; 1ICH; 1NCF; 1TNR; 7K7A; 7KP7; 7KP8; 7KPB
Pfam ID
PF00531 ; PF00020
Sequence
MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCT
KCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVD
RDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECV
SCSNCKKSLECTKLCLPQIENVKGTEDSGTTVLLPLVIFFGLCLLSLLFIGLMYRYQRWK
SKLYSIVCGKSTPEKEGELEGTTTKPLAPNPSFSPTPGFTPTLGFSPVPSSTFTSSSTYT
PGDCPNFAAPRREVAPPYQGADPILATALASDPIPNPLQKWEDSAHKPQSLDTDDPATLY
AVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLEL
LGRVLRDMDLLGCLEDIEEALCGPAALPPAPSLLR
Function
Receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Contributes to the induction of non-cytocidal TNF effects including anti-viral state and activation of the acid sphingomyelinase.
KEGG Pathway
MAPK sig.ling pathway (hsa04010 )
Cytokine-cytokine receptor interaction (hsa04060 )
Viral protein interaction with cytokine and cytokine receptor (hsa04061 )
NF-kappa B sig.ling pathway (hsa04064 )
Sphingolipid sig.ling pathway (hsa04071 )
mTOR sig.ling pathway (hsa04150 )
Apoptosis (hsa04210 )
Apoptosis - multiple species (hsa04215 )
Necroptosis (hsa04217 )
Osteoclast differentiation (hsa04380 )
TNF sig.ling pathway (hsa04668 )
Adipocytokine sig.ling pathway (hsa04920 )
Insulin resistance (hsa04931 )
Non-alcoholic fatty liver disease (hsa04932 )
Alcoholic liver disease (hsa04936 )
Alzheimer disease (hsa05010 )
Amyotrophic lateral sclerosis (hsa05014 )
Pathways of neurodegeneration - multiple diseases (hsa05022 )
Pathogenic Escherichia coli infection (hsa05130 )
Shigellosis (hsa05131 )
Salmonella infection (hsa05132 )
Chagas disease (hsa05142 )
Toxoplasmosis (hsa05145 )
Tuberculosis (hsa05152 )
Hepatitis C (hsa05160 )
Human cytomegalovirus infection (hsa05163 )
Influenza A (hsa05164 )
Human papillomavirus infection (hsa05165 )
Human T-cell leukemia virus 1 infection (hsa05166 )
Kaposi sarcoma-associated herpesvirus infection (hsa05167 )
Herpes simplex virus 1 infection (hsa05168 )
Human immunodeficiency virus 1 infection (hsa05170 )
Coro.virus disease - COVID-19 (hsa05171 )
Lipid and atherosclerosis (hsa05417 )
Fluid shear stress and atherosclerosis (hsa05418 )
Reactome Pathway
Regulation of TNFR1 signaling (R-HSA-5357905 )
TNFR1-induced NF-kappa-B signaling pathway (R-HSA-5357956 )
TNFR1-mediated ceramide production (R-HSA-5626978 )
TNFs bind their physiological receptors (R-HSA-5669034 )
Interleukin-10 signaling (R-HSA-6783783 )
TNF signaling (R-HSA-75893 )
TNFR1-induced proapoptotic signaling (R-HSA-5357786 )

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Autosomal dominant familial periodic fever DISCRNV1 Definitive Autosomal dominant [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 2 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Indomethacin DMSC4A7 Approved Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A) increases the Gastric disorder ADR of Indomethacin. [47]
Epirubicin DMPDW6T Approved Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A) increases the Neutropenia ADR of Epirubicin. [48]
------------------------------------------------------------------------------------
49 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [2]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [3]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [4]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [5]
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [6]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [7]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [8]
Arsenic DMTL2Y1 Approved Arsenic decreases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [9]
Quercetin DM3NC4M Approved Quercetin increases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [10]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [11]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [13]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [14]
Marinol DM70IK5 Approved Marinol increases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [15]
Zoledronate DMIXC7G Approved Zoledronate increases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [16]
Fluorouracil DMUM7HZ Approved Fluorouracil affects the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [17]
Cannabidiol DM0659E Approved Cannabidiol increases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [18]
Hydroquinone DM6AVR4 Approved Hydroquinone increases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [19]
Diethylstilbestrol DMN3UXQ Approved Diethylstilbestrol increases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [20]
Azathioprine DMMZSXQ Approved Azathioprine increases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [21]
Ethanol DMDRQZU Approved Ethanol increases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [15]
Aspirin DM672AH Approved Aspirin increases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [22]
Diclofenac DMPIHLS Approved Diclofenac affects the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [13]
Nicotine DMWX5CO Approved Nicotine decreases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [23]
Mifepristone DMGZQEF Approved Mifepristone increases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [24]
Capsaicin DMGMF6V Approved Capsaicin increases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [25]
Acetic Acid, Glacial DM4SJ5Y Approved Acetic Acid, Glacial increases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [26]
Thalidomide DM70BU5 Approved Thalidomide decreases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [27]
Motexafin gadolinium DMEJKRF Approved Motexafin gadolinium increases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [26]
Dinoprostone DMTYOPD Approved Dinoprostone increases the activity of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [28]
Isoproterenol DMK7MEY Approved Isoproterenol decreases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [29]
Dihydroxyacetone DMM1LG2 Approved Dihydroxyacetone affects the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [30]
Lenalidomide DM6Q7U4 Approved Lenalidomide decreases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [27]
Resveratrol DM3RWXL Phase 3 Resveratrol decreases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [31]
Epigallocatechin gallate DMCGWBJ Phase 3 Epigallocatechin gallate decreases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [32]
Atorvastatin DMF28YC Phase 3 Trial Atorvastatin decreases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [33]
phorbol 12-myristate 13-acetate DMJWD62 Phase 2 phorbol 12-myristate 13-acetate decreases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [34]
Sodium stibogluconate DMH5MVE Phase 2 Sodium stibogluconate decreases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [35]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [23]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide increases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [36]
Dioscin DM5H2W9 Preclinical Dioscin increases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [37]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [38]
3R14S-OCHRATOXIN A DM2KEW6 Investigative 3R14S-OCHRATOXIN A decreases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [39]
Paraquat DMR8O3X Investigative Paraquat decreases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [40]
Glyphosate DM0AFY7 Investigative Glyphosate decreases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [41]
Phencyclidine DMQBEYX Investigative Phencyclidine increases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [42]
4-hydroxy-2-nonenal DM2LJFZ Investigative 4-hydroxy-2-nonenal decreases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [43]
QUERCITRIN DM1DH96 Investigative QUERCITRIN decreases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [44]
Beta-D-Glucose DM5IHYP Investigative Beta-D-Glucose increases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [45]
Aloe-emodin DMPTY8S Investigative Aloe-emodin increases the expression of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [46]
------------------------------------------------------------------------------------
⏷ Show the Full List of 49 Drug(s)
1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT
Drug Name Drug ID Highest Status Interaction REF
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide increases the cleavage of Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A). [12]
------------------------------------------------------------------------------------

References

1 Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
2 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
4 Suppression of mammary carcinoma growth by retinoic acid: proapoptotic genes are targets for retinoic acid receptor and cellular retinoic acid-binding protein II signaling. Cancer Res. 2005 Sep 15;65(18):8193-9. doi: 10.1158/0008-5472.CAN-05-1177.
5 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
6 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
7 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
8 (4-Picolylamino)-17-Estradiol derivative and analogues induce apoptosis with death receptor trail R2/DR5 in MCF-7. Chem Biol Interact. 2023 Jan 5;369:110286. doi: 10.1016/j.cbi.2022.110286. Epub 2022 Nov 29.
9 Application of cDNA microarray to the study of arsenic-induced liver diseases in the population of Guizhou, China. Toxicol Sci. 2001 Jan;59(1):185-92.
10 Quercetin potentiates apoptosis by inhibiting nuclear factor-kappaB signaling in H460 lung cancer cells. Biol Pharm Bull. 2013;36(6):944-51. doi: 10.1248/bpb.b12-01004.
11 Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
12 Iron-mediated H2O2 production as a mechanism for cell type-specific inhibition of tumor necrosis factor alpha-induced but not interleukin-1beta-induced IkappaB kinase complex/nuclear factor-kappaB activation. J Biol Chem. 2005 Jan 28;280(4):2912-23. doi: 10.1074/jbc.M409524200. Epub 2004 Nov 17.
13 Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
14 Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
15 Alcohol and Cannabinoids Differentially Affect HIV Infection and Function of Human Monocyte-Derived Dendritic Cells (MDDC). Front Microbiol. 2015 Dec 22;6:1452. doi: 10.3389/fmicb.2015.01452. eCollection 2015.
16 Effect of zoledronic acid on oral fibroblasts and epithelial cells: a potential mechanism of bisphosphonate-associated osteonecrosis. Br J Haematol. 2009 Mar;144(5):667-76. doi: 10.1111/j.1365-2141.2008.07504.x. Epub 2008 Nov 20.
17 New insights into the mechanisms underlying 5-fluorouracil-induced intestinal toxicity based on transcriptomic and metabolomic responses in human intestinal organoids. Arch Toxicol. 2021 Aug;95(8):2691-2718. doi: 10.1007/s00204-021-03092-2. Epub 2021 Jun 20.
18 Transcriptomic Analysis of Stem Cells Treated with Moringin or Cannabidiol: Analogies and Differences in Inflammation Pathways. Int J Mol Sci. 2019 Nov 30;20(23):6039. doi: 10.3390/ijms20236039.
19 Hydroquinone Exposure Worsens Rheumatoid Arthritis through the Activation of the Aryl Hydrocarbon Receptor and Interleukin-17 Pathways. Antioxidants (Basel). 2021 Jun 7;10(6):929. doi: 10.3390/antiox10060929.
20 Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
21 A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
22 Lunasin, a novel seed peptide, sensitizes human breast cancer MDA-MB-231 cells to aspirin-arrested cell cycle and induced apoptosis. Chem Biol Interact. 2010 Jul 30;186(2):127-34. doi: 10.1016/j.cbi.2010.04.027. Epub 2010 May 21.
23 Effects of tobacco compounds on gene expression in fetal lung fibroblasts. Environ Toxicol. 2008 Aug;23(4):423-34.
24 Mifepristone induced progesterone withdrawal reveals novel regulatory pathways in human endometrium. Mol Hum Reprod. 2007 Sep;13(9):641-54.
25 Capsaicin promotes a more aggressive gene expression phenotype and invasiveness in null-TRPV1 urothelial cancer cells. Carcinogenesis. 2011 May;32(5):686-94. doi: 10.1093/carcin/bgr025. Epub 2011 Feb 10.
26 Motexafin gadolinium and zinc induce oxidative stress responses and apoptosis in B-cell lymphoma lines. Cancer Res. 2005 Dec 15;65(24):11676-88.
27 Circulating endothelial progenitor cells in multiple myeloma: implications and significance. Blood. 2005 Apr 15;105(8):3286-94. doi: 10.1182/blood-2004-06-2101. Epub 2004 Dec 23.
28 Selective inhibition of prostaglandin E2 receptors EP2 and EP4 induces apoptosis of human endometriotic cells through suppression of ERK1/2, AKT, NFkappaB, and beta-catenin pathways and activation of intrinsic apoptotic mechanisms. Mol Endocrinol. 2009 Aug;23(8):1291-305. doi: 10.1210/me.2009-0017. Epub 2009 Apr 30.
29 Isoproterenol effects evaluated in heart slices of human and rat in comparison to rat heart in vivo. Toxicol Appl Pharmacol. 2014 Jan 15;274(2):302-12.
30 The sunless tanning agent dihydroxyacetone induces stress response gene expression and signaling in cultured human keratinocytes and reconstructed epidermis. Redox Biol. 2020 Sep;36:101594. doi: 10.1016/j.redox.2020.101594. Epub 2020 May 29.
31 Experimental and computational studies on newly synthesized resveratrol derivative: a new method for cancer chemoprevention and therapeutics?. OMICS. 2013 Nov;17(11):568-83. doi: 10.1089/omi.2013.0014. Epub 2013 Sep 17.
32 Anti-inflammatory effects of dietary phenolic compounds in an in vitro model of inflamed human intestinal epithelium. Chem Biol Interact. 2010 Dec 5;188(3):659-67.
33 The effects of atorvastatin (10 mg) on systemic inflammation in heart failure. Am J Cardiol. 2005 Dec 15;96(12):1699-704. doi: 10.1016/j.amjcard.2005.07.092. Epub 2005 Oct 28.
34 Shedding of TNF-alpha receptors, blood pressure, and insulin sensitivity in type 2 diabetes mellitus. Am J Physiol Endocrinol Metab. 2002 Apr;282(4):E952-9. doi: 10.1152/ajpendo.00444.2001.
35 Soluble receptors for tumor necrosis factor as markers of disease activity in visceral leishmaniasis. J Infect Dis. 1995 Feb;171(2):498-501. doi: 10.1093/infdis/171.2.498.
36 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
37 Cytotoxicity of dioscin in human gastric carcinoma cells through death receptor and mitochondrial pathways. J Appl Toxicol. 2013 Aug;33(8):712-22. doi: 10.1002/jat.2715. Epub 2012 Feb 14.
38 Genome-wide expression changes induced by bisphenol A, F and S in human stem cell derived hepatocyte-like cells. EXCLI J. 2020 Nov 4;19:1459-1476. doi: 10.17179/excli2020-2934. eCollection 2020.
39 In vitro gene expression data supporting a DNA non-reactive genotoxic mechanism for ochratoxin A. Toxicol Appl Pharmacol. 2007 Apr 15;220(2):216-24.
40 Identification of genes associated with paraquat-induced toxicity in SH-SY5Y cells by PCR array focused on apoptotic pathways. J Toxicol Environ Health A. 2008;71(22):1457-67. doi: 10.1080/15287390802329364.
41 Glyphosate-based herbicides at low doses affect canonical pathways in estrogen positive and negative breast cancer cell lines. PLoS One. 2019 Jul 11;14(7):e0219610. doi: 10.1371/journal.pone.0219610. eCollection 2019.
42 Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.
43 Microarray analysis of H2O2-, HNE-, or tBH-treated ARPE-19 cells. Free Radic Biol Med. 2002 Nov 15;33(10):1419-32.
44 Molecular mechanisms of quercitrin-induced apoptosis in non-small cell lung cancer. Arch Med Res. 2014 Aug;45(6):445-54.
45 Selective regulation of cytokine induction by adenoviral gene transfer of IkappaBalpha into human macrophages: lipopolysaccharide-induced, but not zymosan-induced, proinflammatory cytokines are inhibited, but IL-10 is nuclear factor-kappaB independent. J Immunol. 1999 Mar 1;162(5):2939-45.
46 The molecular effects of aloe-emodin (AE)/liposome-AE on human nonmelanoma skin cancer cells and skin permeation. Chem Res Toxicol. 2009 Dec;22(12):2017-28. doi: 10.1021/tx900318a.
47 ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.
48 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan. Cancer Sci. 2013 Aug;104(8):1074-82. doi: 10.1111/cas.12186. Epub 2013 Jun 10.