Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT3Q1JDY)

DOT Name Focal adhesion kinase 1 (PTK2)
Synonyms FADK 1; EC 2.7.10.2; Focal adhesion kinase-related nonkinase; FRNK; Protein phosphatase 1 regulatory subunit 71; PPP1R71; Protein-tyrosine kinase 2; p125FAK; pp125FAK
Gene Name PTK2
UniProt ID
FAK1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1K04 ; 1K05 ; 1MP8 ; 1OW6 ; 1OW7 ; 1OW8 ; 2ETM ; 2IJM ; 3B71 ; 3BZ3 ; 3PXK ; 3S9O ; 4EBV ; 4EBW ; 4GU6 ; 4GU9 ; 4I4E ; 4I4F ; 4K8A ; 4K9Y ; 4KAB ; 4KAO ; 4NY0 ; 4Q9S ; 6I8Z ; 6LES ; 6PW8 ; 6YOJ ; 6YQ1 ; 6YR9 ; 6YT6 ; 6YVS ; 6YVY ; 6YXV ; 7PI4 ; 7W7Z ; 7W8B ; 7W8I ; 7W9U
EC Number
2.7.10.2
Pfam ID
PF21477 ; PF00373 ; PF18038 ; PF03623 ; PF07714
Sequence
MAAAYLDPNLNHTPNSSTKTHLGTGMERSPGAMERVLKVFHYFESNSEPTTWASIIRHGD
ATDVRGIIQKIVDSHKVKHVACYGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEW
KYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMLEIADQVDQEIALKLGCLEIRRSY
WEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESI
LKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFTQVQ
TIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGTSQSFII
RPQKEGERALPSIPKLANSEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRE
RIELGRCIGEGQFGDVHQGIYMSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDH
PHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESK
RFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFT
SASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWA
YDPSRRPRFTELKAQLSTILEEEKAQQEERMRMESRRQATVSWDSGGSDEAPPKPSRPGY
PSPRSSEGFYPSPQHMVQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQTDSWNHRPQE
IAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLS
RGSIDREDGSLQGPIGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPADSYNE
GVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLA
LRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQM
LTAAHALAVDAKNLLDVIDQARLKMLGQTRPH
Function
Non-receptor protein-tyrosine kinase that plays an essential role in regulating cell migration, adhesion, spreading, reorganization of the actin cytoskeleton, formation and disassembly of focal adhesions and cell protrusions, cell cycle progression, cell proliferation and apoptosis. Required for early embryonic development and placenta development. Required for embryonic angiogenesis, normal cardiomyocyte migration and proliferation, and normal heart development. Regulates axon growth and neuronal cell migration, axon branching and synapse formation; required for normal development of the nervous system. Plays a role in osteogenesis and differentiation of osteoblasts. Functions in integrin signal transduction, but also in signaling downstream of numerous growth factor receptors, G-protein coupled receptors (GPCR), EPHA2, netrin receptors and LDL receptors. Forms multisubunit signaling complexes with SRC and SRC family members upon activation; this leads to the phosphorylation of additional tyrosine residues, creating binding sites for scaffold proteins, effectors and substrates. Regulates numerous signaling pathways. Promotes activation of phosphatidylinositol 3-kinase and the AKT1 signaling cascade. Promotes activation of MAPK1/ERK2, MAPK3/ERK1 and the MAP kinase signaling cascade. Promotes localized and transient activation of guanine nucleotide exchange factors (GEFs) and GTPase-activating proteins (GAPs), and thereby modulates the activity of Rho family GTPases. Signaling via CAS family members mediates activation of RAC1. Phosphorylates NEDD9 following integrin stimulation. Recruits the ubiquitin ligase MDM2 to P53/TP53 in the nucleus, and thereby regulates P53/TP53 activity, P53/TP53 ubiquitination and proteasomal degradation. Phosphorylates SRC; this increases SRC kinase activity. Phosphorylates ACTN1, ARHGEF7, GRB7, RET and WASL. Promotes phosphorylation of PXN and STAT1; most likely PXN and STAT1 are phosphorylated by a SRC family kinase that is recruited to autophosphorylated PTK2/FAK1, rather than by PTK2/FAK1 itself. Promotes phosphorylation of BCAR1; GIT2 and SHC1; this requires both SRC and PTK2/FAK1. Promotes phosphorylation of BMX and PIK3R1. Isoform 6 (FRNK) does not contain a kinase domain and inhibits PTK2/FAK1 phosphorylation and signaling. Its enhanced expression can attenuate the nuclear accumulation of LPXN and limit its ability to enhance serum response factor (SRF)-dependent gene transcription; [Isoform 6]: Isoform 6 (FRNK) does not contain a kinase domain and inhibits PTK2/FAK1 phosphorylation and signaling. Its enhanced expression can attenuate the nuclear accumulation of LPXN and limit its ability to enhance serum response factor (SRF)-dependent gene transcription.
Tissue Specificity Detected in B and T-lymphocytes. Isoform 1 and isoform 6 are detected in lung fibroblasts (at protein level). Ubiquitous. Expressed in epithelial cells (at protein level) .
KEGG Pathway
Endocrine resistance (hsa01522 )
ErbB sig.ling pathway (hsa04012 )
Chemokine sig.ling pathway (hsa04062 )
Efferocytosis (hsa04148 )
PI3K-Akt sig.ling pathway (hsa04151 )
Axon guidance (hsa04360 )
VEGF sig.ling pathway (hsa04370 )
Focal adhesion (hsa04510 )
Leukocyte transendothelial migration (hsa04670 )
Regulation of actin cytoskeleton (hsa04810 )
Growth hormone synthesis, secretion and action (hsa04935 )
Bacterial invasion of epithelial cells (hsa05100 )
Shigellosis (hsa05131 )
Yersinia infection (hsa05135 )
Amoebiasis (hsa05146 )
Human cytomegalovirus infection (hsa05163 )
Human papillomavirus infection (hsa05165 )
Human immunodeficiency virus 1 infection (hsa05170 )
Pathways in cancer (hsa05200 )
Transcriptio.l misregulation in cancer (hsa05202 )
Proteoglycans in cancer (hsa05205 )
Chemical carcinogenesis - reactive oxygen species (hsa05208 )
Small cell lung cancer (hsa05222 )
Lipid and atherosclerosis (hsa05417 )
Fluid shear stress and atherosclerosis (hsa05418 )
Reactome Pathway
Regulation of actin dynamics for phagocytic cup formation (R-HSA-2029482 )
Integrin signaling (R-HSA-354192 )
GRB2 (R-HSA-354194 )
p130Cas linkage to MAPK signaling for integrins (R-HSA-372708 )
NCAM signaling for neurite out-growth (R-HSA-375165 )
Signal regulatory protein family interactions (R-HSA-391160 )
EPHB-mediated forward signaling (R-HSA-3928662 )
DCC mediated attractive signaling (R-HSA-418885 )
VEGFA-VEGFR2 Pathway (R-HSA-4420097 )
RHO GTPases Activate WASPs and WAVEs (R-HSA-5663213 )
RAF/MAP kinase cascade (R-HSA-5673001 )
MET activates PTK2 signaling (R-HSA-8874081 )
Extra-nuclear estrogen signaling (R-HSA-9009391 )
Estrogen-dependent nuclear events downstream of ESR-membrane signaling (R-HSA-9634638 )
FCGR3A-mediated phagocytosis (R-HSA-9664422 )
Apoptotic cleavage of cellular proteins (R-HSA-111465 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 3 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Fluorouracil DMUM7HZ Approved Focal adhesion kinase 1 (PTK2) decreases the response to substance of Fluorouracil. [53]
Gemcitabine DMSE3I7 Approved Focal adhesion kinase 1 (PTK2) decreases the response to substance of Gemcitabine. [54]
Mannitol DMSCDY9 Approved Focal adhesion kinase 1 (PTK2) increases the Apoptosis ADR of Mannitol. [55]
------------------------------------------------------------------------------------
27 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Focal adhesion kinase 1 (PTK2). [1]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Focal adhesion kinase 1 (PTK2). [3]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Focal adhesion kinase 1 (PTK2). [4]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Focal adhesion kinase 1 (PTK2). [6]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Focal adhesion kinase 1 (PTK2). [8]
Arsenic DMTL2Y1 Approved Arsenic decreases the expression of Focal adhesion kinase 1 (PTK2). [9]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Focal adhesion kinase 1 (PTK2). [10]
Carbamazepine DMZOLBI Approved Carbamazepine decreases the activity of Focal adhesion kinase 1 (PTK2). [13]
Zoledronate DMIXC7G Approved Zoledronate increases the expression of Focal adhesion kinase 1 (PTK2). [15]
Irinotecan DMP6SC2 Approved Irinotecan decreases the expression of Focal adhesion kinase 1 (PTK2). [17]
Diclofenac DMPIHLS Approved Diclofenac affects the expression of Focal adhesion kinase 1 (PTK2). [18]
Clozapine DMFC71L Approved Clozapine increases the expression of Focal adhesion kinase 1 (PTK2). [20]
Menthol DMG2KW7 Approved Menthol decreases the expression of Focal adhesion kinase 1 (PTK2). [22]
Cocaine DMSOX7I Approved Cocaine decreases the expression of Focal adhesion kinase 1 (PTK2). [23]
Simvastatin DM30SGU Approved Simvastatin decreases the activity of Focal adhesion kinase 1 (PTK2). [24]
Mebendazole DMO14SG Approved Mebendazole decreases the expression of Focal adhesion kinase 1 (PTK2). [26]
Sodium chloride DMM3950 Approved Sodium chloride increases the expression of Focal adhesion kinase 1 (PTK2). [27]
Resveratrol DM3RWXL Phase 3 Resveratrol decreases the expression of Focal adhesion kinase 1 (PTK2). [30]
phorbol 12-myristate 13-acetate DMJWD62 Phase 2 phorbol 12-myristate 13-acetate increases the expression of Focal adhesion kinase 1 (PTK2). [32]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Focal adhesion kinase 1 (PTK2). [33]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Focal adhesion kinase 1 (PTK2). [38]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Focal adhesion kinase 1 (PTK2). [39]
Deguelin DMXT7WG Investigative Deguelin increases the expression of Focal adhesion kinase 1 (PTK2). [40]
3R14S-OCHRATOXIN A DM2KEW6 Investigative 3R14S-OCHRATOXIN A increases the expression of Focal adhesion kinase 1 (PTK2). [41]
D-glucose DMMG2TO Investigative D-glucose decreases the expression of Focal adhesion kinase 1 (PTK2). [42]
4-hydroxy-2-nonenal DM2LJFZ Investigative 4-hydroxy-2-nonenal decreases the expression of Focal adhesion kinase 1 (PTK2). [43]
U0126 DM31OGF Investigative U0126 decreases the expression of Focal adhesion kinase 1 (PTK2). [44]
------------------------------------------------------------------------------------
⏷ Show the Full List of 27 Drug(s)
24 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the methylation of Focal adhesion kinase 1 (PTK2). [2]
Testosterone DM7HUNW Approved Testosterone increases the phosphorylation of Focal adhesion kinase 1 (PTK2). [12]
Marinol DM70IK5 Approved Marinol increases the phosphorylation of Focal adhesion kinase 1 (PTK2). [14]
Rosiglitazone DMILWZR Approved Rosiglitazone decreases the phosphorylation of Focal adhesion kinase 1 (PTK2). [16]
Dasatinib DMJV2EK Approved Dasatinib decreases the phosphorylation of Focal adhesion kinase 1 (PTK2). [19]
Indomethacin DMSC4A7 Approved Indomethacin decreases the phosphorylation of Focal adhesion kinase 1 (PTK2). [21]
Terbinafine DMI6HUW Approved Terbinafine decreases the phosphorylation of Focal adhesion kinase 1 (PTK2). [28]
Halothane DM80OZ5 Approved Halothane decreases the phosphorylation of Focal adhesion kinase 1 (PTK2). [29]
Genistein DM0JETC Phase 2/3 Genistein increases the phosphorylation of Focal adhesion kinase 1 (PTK2). [31]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 affects the phosphorylation of Focal adhesion kinase 1 (PTK2). [34]
Flavonoid derivative 1 DMCQP0B Patented Flavonoid derivative 1 decreases the phosphorylation of Focal adhesion kinase 1 (PTK2). [35]
Geldanamycin DMS7TC5 Discontinued in Phase 2 Geldanamycin decreases the phosphorylation of Focal adhesion kinase 1 (PTK2). [36]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the phosphorylation of Focal adhesion kinase 1 (PTK2). [37]
Cordycepin DM72Y01 Investigative Cordycepin decreases the phosphorylation of Focal adhesion kinase 1 (PTK2). [45]
Chrysin DM7V2LG Investigative Chrysin decreases the phosphorylation of Focal adhesion kinase 1 (PTK2). [46]
CATECHIN DMY38SB Investigative CATECHIN increases the phosphorylation of Focal adhesion kinase 1 (PTK2). [12]
Daidzein DMRFTJX Investigative Daidzein increases the phosphorylation of Focal adhesion kinase 1 (PTK2). [31]
Tetramethylbutylphenol DMW9CH2 Investigative Tetramethylbutylphenol increases the phosphorylation of Focal adhesion kinase 1 (PTK2). [47]
Caffeic acid phenethyl ester DMRJKIV Investigative Caffeic acid phenethyl ester decreases the phosphorylation of Focal adhesion kinase 1 (PTK2). [48]
Mepacrine DMU8L7C Investigative Mepacrine decreases the phosphorylation of Focal adhesion kinase 1 (PTK2). [49]
LPA DMI5XR1 Investigative LPA increases the phosphorylation of Focal adhesion kinase 1 (PTK2). [50]
tryptanthrin DMTRYCI Investigative tryptanthrin decreases the phosphorylation of Focal adhesion kinase 1 (PTK2). [51]
[3H]oxotremorine-M DM5L7D3 Investigative [3H]oxotremorine-M increases the phosphorylation of Focal adhesion kinase 1 (PTK2). [50]
PF-228 DM32FKD Investigative PF-228 decreases the phosphorylation of Focal adhesion kinase 1 (PTK2). [52]
------------------------------------------------------------------------------------
⏷ Show the Full List of 24 Drug(s)
5 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT
Drug Name Drug ID Highest Status Interaction REF
Doxorubicin DMVP5YE Approved Doxorubicin affects the cleavage of Focal adhesion kinase 1 (PTK2). [5]
Estradiol DMUNTE3 Approved Estradiol increases the degradation of Focal adhesion kinase 1 (PTK2). [7]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide increases the cleavage of Focal adhesion kinase 1 (PTK2). [11]
Fulvestrant DM0YZC6 Approved Fulvestrant increases the degradation of Focal adhesion kinase 1 (PTK2). [7]
Docetaxel DMDI269 Approved Docetaxel increases the cleavage of Focal adhesion kinase 1 (PTK2). [25]
------------------------------------------------------------------------------------

References

1 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2 Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
3 Effect of all-trans retinoic acid on sodium/iodide symporter expression, radioiodine uptake and gene expression profiles in a human anaplastic thyroid carcinoma cell line. Nucl Med Biol. 2006 Oct;33(7):875-82. doi: 10.1016/j.nucmedbio.2006.07.004.
4 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
5 Two distinct modes of cell death induced by doxorubicin: apoptosis and cell death through mitotic catastrophe accompanied by senescence-like phenotype. Oncogene. 2005 Jul 14;24(30):4765-77.
6 The thioxotriazole copper(II) complex A0 induces endoplasmic reticulum stress and paraptotic death in human cancer cells. J Biol Chem. 2009 Sep 4;284(36):24306-19.
7 Estrogen and pure antiestrogen fulvestrant (ICI 182 780) augment cell-matrigel adhesion of MCF-7 breast cancer cells through a novel G protein coupled estrogen receptor (GPR30)-to-calpain signaling axis. Toxicol Appl Pharmacol. 2014 Mar 1;275(2):176-81. doi: 10.1016/j.taap.2014.01.005. Epub 2014 Jan 17.
8 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
9 Defective beta1-integrins expression in arsenical keratosis and arsenic-treated cultured human keratinocytes. J Cutan Pathol. 2006 Feb;33(2):129-38. doi: 10.1111/j.0303-6987.2006.00361.x.
10 Quercetin inhibits migration and invasion of SAS human oral cancer cells through inhibition of NF-B and matrix metalloproteinase-2/-9 signaling pathways. Anticancer Res. 2013 May;33(5):1941-50.
11 Cleavage of focal adhesion kinase is an early marker and modulator of oxidative stress-induced apoptosis. Chem Biol Interact. 2008 Jan 10;171(1):57-66. doi: 10.1016/j.cbi.2007.08.009. Epub 2007 Aug 19.
12 Monomeric and oligomeric flavanols are agonists of membrane androgen receptors. Exp Cell Res. 2005 Oct 1;309(2):329-39. doi: 10.1016/j.yexcr.2005.06.011.
13 Inhibition of tumour spheroid-induced prometastatic intravasation gates in the lymph endothelial cell barrier by carbamazepine: drug testing in a 3D model. Arch Toxicol. 2014 Mar;88(3):691-9.
14 Activation of cannabinoid receptors promote periodontal cell adhesion and migration. J Clin Periodontol. 2019 Dec;46(12):1264-1272. doi: 10.1111/jcpe.13190. Epub 2019 Oct 22.
15 The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
16 PPARgamma activator rosiglitazone inhibits cell migration via upregulation of PTEN in human hepatocarcinoma cell line BEL-7404. Cancer Biol Ther. 2006 Aug;5(8):1008-14. doi: 10.4161/cbt.5.8.2887. Epub 2006 Aug 7.
17 Clinical determinants of response to irinotecan-based therapy derived from cell line models. Clin Cancer Res. 2008 Oct 15;14(20):6647-55.
18 Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
19 Dasatinib (BMS-354825) selectively induces apoptosis in lung cancer cells dependent on epidermal growth factor receptor signaling for survival. Cancer Res. 2006 Jun 1;66(11):5542-8. doi: 10.1158/0008-5472.CAN-05-4620.
20 Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
21 Indomethacin delays gastric restitution: association with the inhibition of focal adhesion kinase and tensin phosphorylation and reduced actin stress fibers. Exp Biol Med (Maywood). 2002 Jun;227(6):412-24. doi: 10.1177/153537020222700607.
22 Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
23 Transcriptional profiling in the human prefrontal cortex: evidence for two activational states associated with cocaine abuse. Pharmacogenomics J. 2003;3(1):27-40.
24 Simvastatin inactivates beta1-integrin and extracellular signal-related kinase signaling and inhibits cell proliferation in head and neck squamous cell carcinoma cells. Cancer Sci. 2007 Jun;98(6):890-9.
25 Focal adhesion kinase silencing augments docetaxel-mediated apoptosis in ovarian cancer cells. Clin Cancer Res. 2005 Dec 15;11(24 Pt 1):8829-36. doi: 10.1158/1078-0432.CCR-05-1728.
26 Flubendazole and mebendazole impair migration and epithelial to mesenchymal transition in oral cell lines. Chem Biol Interact. 2018 Sep 25;293:124-132. doi: 10.1016/j.cbi.2018.07.026. Epub 2018 Jul 31.
27 Neoplastic-like transformation effect of single-walled and multi-walled carbon nanotubes compared to asbestos on human lung small airway epithelial cells. Nanotoxicology. 2014 Aug;8(5):485-507.
28 Terbinafine inhibits endothelial cell migration through suppression of the Rho-mediated pathway. Mol Cancer Ther. 2006 Dec;5(12):3130-8. doi: 10.1158/1535-7163.MCT-06-0457.
29 Disruption of FAK signaling: a side mechanism in cytotoxicity. Toxicology. 2008 Mar 12;245(1-2):1-10. doi: 10.1016/j.tox.2007.12.003. Epub 2007 Dec 15.
30 Molecular mechanisms of resveratrol action in lung cancer cells using dual protein and microarray analyses. Cancer Res. 2007 Dec 15;67(24):12007-17. doi: 10.1158/0008-5472.CAN-07-2464.
31 Flavonoid effects relevant to cancer. J Nutr. 2002 Nov;132(11 Suppl):3482S-3489S. doi: 10.1093/jn/132.11.3482S.
32 Pharmacological inhibition of protein kinase D suppresses epithelial ovarian cancer via MAPK/ERK1/2/Runx2 signalling axis. Cell Signal. 2023 Oct;110:110849. doi: 10.1016/j.cellsig.2023.110849. Epub 2023 Aug 8.
33 Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
34 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
35 Transinactivation of the epidermal growth factor receptor tyrosine kinase and focal adhesion kinase phosphorylation by dietary flavonoids: effect on invasive potential of human carcinoma cells. Biochem Pharmacol. 2004 Jun 1;67(11):2103-14. doi: 10.1016/j.bcp.2004.02.023.
36 Geldanamycin inhibits migration of glioma cells in vitro: a potential role for hypoxia-inducible factor (HIF-1alpha) in glioma cell invasion. J Cell Physiol. 2003 Aug;196(2):394-402. doi: 10.1002/jcp.10306.
37 Bisphenol A Promotes the Invasive and Metastatic Potential of Ductal Carcinoma In Situ and Protumorigenic Polarization of Macrophages. Toxicol Sci. 2019 Aug 1;170(2):283-295. doi: 10.1093/toxsci/kfz119.
38 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
39 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
40 Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
41 Inhibition of CXCL12-mediated chemotaxis of Jurkat cells by direct immunotoxicants. Arch Toxicol. 2016 Jul;90(7):1685-94. doi: 10.1007/s00204-015-1585-7. Epub 2015 Aug 28.
42 Non-nutritional sweeteners effects on endothelial vascular function. Toxicol In Vitro. 2020 Feb;62:104694. doi: 10.1016/j.tiv.2019.104694. Epub 2019 Oct 23.
43 Microarray analysis of H2O2-, HNE-, or tBH-treated ARPE-19 cells. Free Radic Biol Med. 2002 Nov 15;33(10):1419-32.
44 Protein Kinase D2 and D3 Promote Prostate Cancer Cell Bone Metastasis by Positively Regulating Runx2 in a MEK/ERK1/2-Dependent Manner. Am J Pathol. 2023 May;193(5):624-637. doi: 10.1016/j.ajpath.2023.01.004. Epub 2023 Feb 3.
45 Cordycepin attenuates migration and invasion of HSC-4 oral squamous carcinoma cells through autophagy-dependent FAK/Akt and MMP2/MMP9 suppression. J Dent Sci. 2022 Oct;17(4):1677-1688. doi: 10.1016/j.jds.2022.03.002. Epub 2022 Mar 20.
46 Chrysin inhibit human melanoma A375.S2 cell migration and invasion via affecting MAPK signaling and NF-B signaling pathway in vitro. Environ Toxicol. 2019 Apr;34(4):434-442. doi: 10.1002/tox.22697. Epub 2018 Dec 22.
47 Oncogenic Potential of Bisphenol A and Common Environmental Contaminants in Human Mammary Epithelial Cells. Int J Mol Sci. 2020 May 25;21(10):3735. doi: 10.3390/ijms21103735.
48 Colon cancer chemopreventive drugs modulate integrin-mediated signaling pathways. Clin Cancer Res. 2000 Mar;6(3):949-56.
49 Quinacrine is active in preclinical models of glioblastoma through suppressing angiogenesis, inducing oxidative stress and activating AMPK. Toxicol In Vitro. 2022 Sep;83:105420. doi: 10.1016/j.tiv.2022.105420. Epub 2022 Jun 17.
50 Attenuation of focal adhesion kinase signaling following depletion of agonist-sensitive pools of phosphatidylinositol 4,5-bisphosphate. J Neurochem. 1999 Nov;73(5):1933-44.
51 Indigo naturalis and its component tryptanthrin exert anti-angiogenic effect by arresting cell cycle and inhibiting Akt and FAK signaling in human vascular endothelial cells. J Ethnopharmacol. 2015 Nov 4;174:474-81. doi: 10.1016/j.jep.2015.08.050. Epub 2015 Sep 1.
52 Aryl hydrocarbon receptor-dependent up-regulation of the heterodimeric amino acid transporter LAT1 (SLC7A5)/CD98hc (SLC3A2) by diesel exhaust particle extract in human bronchial epithelial cells. Toxicol Appl Pharmacol. 2016 Jan 1;290:74-85.
53 Effect of focal adhesion kinase (FAK) downregulation with FAK antisense oligonucleotides and 5-fluorouracil on the viability of melanoma cell lines. Melanoma Res. 2005 Oct;15(5):357-62. doi: 10.1097/00008390-200510000-00003.
54 RNA interference targeting focal adhesion kinase enhances pancreatic adenocarcinoma gemcitabine chemosensitivity. Biochem Biophys Res Commun. 2003 Nov 21;311(3):786-92. doi: 10.1016/j.bbrc.2003.10.060.
55 ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.