Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT4VPNGY)

• DOT Name: Involucrin (IVL)
• Gene Name: IVL
• Related Disease:
  Oral lichen planus
  Spinocerebellar ataxia type 1
  Spinocerebellar ataxia type 3
  Actinic keratosis
  Advanced cancer
  Atopic dermatitis
  Central nervous system lymphoma
  Exfoliative dermatitis
  Hailey-Hailey disease
  Head-neck squamous cell carcinoma
  Hepatitis B virus infection
  Hepatocellular carcinoma
  Hereditary spherocytosis type 1
  Immunodeficiency
  Neoplasm
  Psoriasis
  Skin disease
  Small lymphocytic lymphoma
  Striate palmoplantar keratoderma
  Graft-versus-host disease
  Lichen planus
  Skin cancer
  Skin neoplasm
  Carcinoma of esophagus
  Esophageal cancer
  Neoplasm of esophagus
  Cutaneous squamous cell carcinoma
  Epidermodysplasia verruciformis
  Epidermolysis bullosa simplex
  Squamous cell carcinoma
  Type-1 diabetes
• UniProt ID: INVO_HUMAN
• Pfam ID: PF00904 ; PF10583
• Sequence:
  MSQQHTLPVTLSPALSQELLKTVPPPVNTHQEQMKQPTPLPPPCQKVPVELPVEVPSKQE
  EKHMTAVKGLPEQECEQQQKEPQEQELQQQHWEQHEEYQKAENPEQQLKQEKTQRDQQLN
  KQLEEEKKLLDQQLDQELVKRDEQLGMKKEQLLELPEQQEGHLKHLEQQEGQLKHPEQQE
  GQLELPEQQEGQLELPEQQEGQLELPEQQEGQLELPEQQEGQLELPEQQEGQLELPQQQE
  GQLELSEQQEGQLELSEQQEGQLKHLEHQEGQLEVPEEQMGQLKYLEQQEGQLKHLDQQE
  KQPELPEQQMGQLKHLEQQEGQPKHLEQQEGQLEQLEEQEGQLKHLEQQEGQLEHLEHQE
  GQLGLPEQQVLQLKQLEKQQGQPKHLEEEEGQLKHLVQQEGQLKHLVQQEGQLEQQERQV
  EHLEQQVGQLKHLEEQEGQLKHLEQQQGQLEVPEQQVGQPKNLEQEEKQLELPEQQEGQV
  KHLEKQEAQLELPEQQVGQPKHLEQQEKHLEHPEQQDGQLKHLEQQEGQLKDLEQQKGQL
  EQPVFAPAPGQVQDIQPALPTKGEVLLPVEHQQQKQEVQWPPKHK
• Function: Part of the insoluble cornified cell envelope (CE) of stratified squamous epithelia.
• Tissue Specificity: Keratinocytes of epidermis and other stratified squamous epithelia.
• Reactome Pathway: Formation of the cornified envelope (R-HSA-6809371)

Molecular Interaction Atlas (MIA) of This DOT

31 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Oral lichen planus	DISVEAJA	Definitive	Biomarker	[1]
Spinocerebellar ataxia type 1	DISF7BO2	Definitive	Genetic Variation	[2]
Spinocerebellar ataxia type 3	DISQBQID	Definitive	Genetic Variation	[2]
Actinic keratosis	DISR1RC5	Strong	Altered Expression	[3]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[4]
Atopic dermatitis	DISTCP41	Strong	Altered Expression	[5]
Central nervous system lymphoma	DISBYQTA	Strong	Biomarker	[6]
Exfoliative dermatitis	DISQEWIW	Strong	Biomarker	[7]
Hailey-Hailey disease	DISCM9SG	Strong	Altered Expression	[8]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Biomarker	[9]
Hepatitis B virus infection	DISLQ2XY	Strong	Biomarker	[10]
Hepatocellular carcinoma	DIS0J828	Strong	Genetic Variation	[10]
Hereditary spherocytosis type 1	DIS34V1Z	Strong	Altered Expression	[11]
Immunodeficiency	DIS093I0	Strong	Biomarker	[12]
Neoplasm	DISZKGEW	Strong	Biomarker	[13]
Psoriasis	DIS59VMN	Strong	Altered Expression	[14]
Skin disease	DISDW8R6	Strong	Biomarker	[7]
Small lymphocytic lymphoma	DIS30POX	Strong	Biomarker	[15]
Striate palmoplantar keratoderma	DISLGEYP	Strong	Altered Expression	[16]
Graft-versus-host disease	DIS0QADF	moderate	Altered Expression	[5]
Lichen planus	DISRPMMS	moderate	Altered Expression	[5]
Skin cancer	DISTM18U	moderate	Biomarker	[17]
Skin neoplasm	DIS16DDV	moderate	Biomarker	[17]
Carcinoma of esophagus	DISS6G4D	Disputed	Altered Expression	[18]
Esophageal cancer	DISGB2VN	Disputed	Altered Expression	[18]
Neoplasm of esophagus	DISOLKAQ	Disputed	Altered Expression	[18]
Cutaneous squamous cell carcinoma	DIS3LXUG	Limited	Biomarker	[19]
Epidermodysplasia verruciformis	DIS54WBS	Limited	Altered Expression	[20]
Epidermolysis bullosa simplex	DIS2CZ6X	Limited	Altered Expression	[21]
Squamous cell carcinoma	DISQVIFL	Limited	Altered Expression	[22]
Type-1 diabetes	DIS7HLUB	Limited	Altered Expression	[23]

25 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Involucrin (IVL).	[24]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Involucrin (IVL).	[25]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Involucrin (IVL).	[26]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Involucrin (IVL).	[27]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Involucrin (IVL).	[28]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of Involucrin (IVL).	[29]
Nicotine	DMWX5CO	Approved	Nicotine decreases the expression of Involucrin (IVL).	[30]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of Involucrin (IVL).	[29]
Alitretinoin	DMME8LH	Approved	Alitretinoin decreases the expression of Involucrin (IVL).	[31]
Ursodeoxycholic acid	DMCUT21	Approved	Ursodeoxycholic acid decreases the expression of Involucrin (IVL).	[32]
Hydrocortisone	DMGEMB7	Approved	Hydrocortisone decreases the expression of Involucrin (IVL).	[33]
Beta-carotene	DM0RXBT	Approved	Beta-carotene increases the expression of Involucrin (IVL).	[34]
Bexarotene	DMOBIKY	Approved	Bexarotene decreases the expression of Involucrin (IVL).	[31]
Vitamin A	DMJ2AH4	Approved	Vitamin A increases the expression of Involucrin (IVL).	[34]
Calcipotriol	DM03CP7	Approved	Calcipotriol decreases the expression of Involucrin (IVL).	[27]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the expression of Involucrin (IVL).	[36]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Involucrin (IVL).	[38]
PMID26560530-Compound-34	DMLGZPO	Patented	PMID26560530-Compound-34 decreases the expression of Involucrin (IVL).	[32]
Perillyl alcohol	DMFWC3O	Discontinued in Phase 2	Perillyl alcohol decreases the expression of Involucrin (IVL).	[32]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Involucrin (IVL).	[28]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate increases the expression of Involucrin (IVL).	[40]
all-trans-4-oxo-retinoic acid	DMM2R1N	Investigative	all-trans-4-oxo-retinoic acid increases the expression of Involucrin (IVL).	[34]
Protoporphyrin IX	DMWYE7A	Investigative	Protoporphyrin IX decreases the expression of Involucrin (IVL).	[41]
TTNPB	DMSABD0	Investigative	TTNPB decreases the expression of Involucrin (IVL).	[31]
Tyrphostin Ag-1478	DM87ZIH	Investigative	Tyrphostin Ag-1478 increases the expression of Involucrin (IVL).	[42]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
DNCB	DMDTVYC	Phase 2	DNCB affects the binding of Involucrin (IVL).	[35]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Involucrin (IVL).	[37]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Involucrin (IVL).	[39]

References

• [1] Ectopic transglutaminase 1 and 3 expression accelerating keratinization in oral lichen planus.J Int Med Res. 2018 Nov;46(11):4722-4730. doi: 10.1177/0300060518798261. Epub 2018 Sep 13.
• [2] Peptides containing glutamine repeats as substrates for transglutaminase-catalyzed cross-linking: relevance to diseases of the nervous system.Proc Natl Acad Sci U S A. 1996 Dec 10;93(25):14580-5. doi: 10.1073/pnas.93.25.14580.
• [3] Immunohistochemical localization of keratins and involucrin in solar keratosis and Bowen's disease.Am J Dermatopathol. 1995 Apr;17(2):151-7. doi: 10.1097/00000372-199504000-00007.
• [4] Total inhibition of involucrin synthesis by a novel two-step antisense procedure. Further examination of the relationship between differentiation and malignancy in hybrid cells.J Cell Sci. 1992 Aug;102 ( Pt 4):799-805. doi: 10.1242/jcs.102.4.799.
• [5] Atopic Dermatitis-like Graft-versus-host Disease and Lichen Planus-like Graft-versus-host Disease: Alterations in Skin Barrier Function and Related Molecules.Chin Med J (Engl). 2017 Jun 20;130(12):1459-1466. doi: 10.4103/0366-6999.207475.
• [6] Different imaging patterns of PCNSL and IVL: a case report.BMC Neurol. 2019 Dec 3;19(1):311. doi: 10.1186/s12883-019-1548-3.
• [7] Flow-cytometric investigation of epidermal cell characteristics in monogenic disorders of keratinization and their modulation by topical calcipotriol treatment.Acta Derm Venereol. 1996 Mar;76(2):97-101. doi: 10.2340/000155557697101.
• [8] Involucrin expression is decreased in Hailey-Hailey keratinocytes owing to increased involucrin mRNA degradation.J Invest Dermatol. 2007 Aug;127(8):1973-9. doi: 10.1038/sj.jid.5700785. Epub 2007 Mar 29.
• [9] FOXM1 induces a global methylation signature that mimics the cancer epigenome in head and neck squamous cell carcinoma.PLoS One. 2012;7(3):e34329. doi: 10.1371/journal.pone.0034329. Epub 2012 Mar 26.
• [10] High Level of Hepatitis B Core-Related Antigen Associated With Increased Risk of Hepatocellular Carcinoma in Patients With Chronic HBV Infection of Intermediate Viral Load.Gastroenterology. 2019 Dec;157(6):1518-1529.e3. doi: 10.1053/j.gastro.2019.08.028. Epub 2019 Aug 27.
• [11] Investigation of Immune-Regulatory Effects of Mageumsan Hot Spring via Protein Microarray In Vitro.Ann Dermatol. 2018 Jun;30(3):322-330. doi: 10.5021/ad.2018.30.3.322. Epub 2018 Apr 23.
• [12] Squamous metaplasia induced by transfection of human papillomavirus DNA into cultured adenocarcinoma cells.Mol Pathol. 2003 Apr;56(2):97-108. doi: 10.1136/mp.56.2.97.
• [13] Tissue-engineered 3D melanoma model with blood and lymphatic capillaries for drug development.Sci Rep. 2018 Sep 4;8(1):13191. doi: 10.1038/s41598-018-31502-6.
• [14] Downregulation of involucrin in psoriatic lesions following therapy with propylthiouracil, an anti-thyroid thioureylene: immunohistochemistry and gene expression analysis.Int J Dermatol. 2015 Mar;54(3):302-6. doi: 10.1111/ijd.12565. Epub 2014 Sep 30.
• [15] Characterization of sunburn cells after exposure to ultraviolet light.Photodermatol Photoimmunol Photomed. 1995 Aug;11(4):149-54. doi: 10.1111/j.1600-0781.1995.tb00157.x.
• [16] Striate palmoplantar keratoderma arising from desmoplakin and desmoglein 1 mutations is associated with contrasting perturbations of desmosomes and the keratin filament network.Br J Dermatol. 2004 May;150(5):878-91. doi: 10.1111/j.1365-2133.2004.05996.x.
• [17] Arsenic-induced malignant transformation of human keratinocytes: involvement of Nrf2.Free Radic Biol Med. 2008 Sep 1;45(5):651-8. doi: 10.1016/j.freeradbiomed.2008.05.020. Epub 2008 Jun 3.
• [18] Induction of differentiation-dependent apoptosis in human esophageal squamous cell carcinoma by adenovirus-mediated p21sdi1 gene transfer.Clin Cancer Res. 1999 Dec;5(12):4233-41.
• [19] Altered gene expression in squamous cell carcinoma arising from congenital unilateral linear porokeratosis.Clin Exp Dermatol. 2012 Oct;37(7):781-5. doi: 10.1111/j.1365-2230.2012.04393.x.
• [20] Comparative analysis of the expression of cytokeratins (1, 10, 14, 16, 4), involucrin, filaggrin and e-cadherin in plane warts and epidermodysplasia verruciformis plane wart-type lesions.J Cutan Pathol. 2009 Jun;36(6):647-54. doi: 10.1111/j.1600-0560.2008.01127.x.
• [21] Recessive dystrophic epidermolysis bullosa skin displays a chronic growth-activated immunophenotype. Implications for carcinogenesis.Arch Dermatol. 1990 Jan;126(1):78-83.
• [22] Increased invasive behaviour in cutaneous squamous cell carcinoma with loss of basement-membrane type VII collagen.J Cell Sci. 2009 Jun 1;122(Pt 11):1788-99. doi: 10.1242/jcs.042895. Epub 2009 May 12.
• [23] CTRP9 Regulates Growth, Differentiation, and Apoptosis in Human Keratinocytes through TGF1-p38-Dependent Pathway.Mol Cells. 2017 Dec 31;40(12):906-915. doi: 10.14348/molcells.2017.0097. Epub 2017 Nov 16.
• [24] Retinoic acid receptors as regulators of human epidermal keratinocyte differentiation. Mol Endocrinol. 1992 May;6(5):667-76. doi: 10.1210/mend.6.5.1318502.
• [25] Effects of low-dose Bisphenol A on calcium ion influx and on genes of proliferation and differentiation in immortalized human gingival cells in vitro: The role of estrogen receptor beta. Dent Mater. 2017 Sep;33(9):1021-1032. doi: 10.1016/j.dental.2017.06.011. Epub 2017 Jul 9.
• [26] Proteomics-based identification of differentially abundant proteins from human keratinocytes exposed to arsenic trioxide. J Proteomics Bioinform. 2014 Jul;7(7):166-178.
• [27] Effects of 1 alpha,25-dihydroxy-vitamin D3 and calcipotriol on organotypic cultures of outer root sheath cells: a potential model to evaluate antipsoriatic drugs. Arch Dermatol Res. 1993;285(7):402-9. doi: 10.1007/BF00372133.
• [28] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [29] Retinoic acid and hydroquinone induce inverse expression patterns on cornified envelope-associated proteins: implication in skin irritation. J Dermatol Sci. 2014 Nov;76(2):112-9. doi: 10.1016/j.jdermsci.2014.08.003. Epub 2014 Aug 26.
• [30] Effects of nicotine on proliferation, cell cycle, and differentiation in immortalized and malignant oral keratinocytes. J Oral Pathol Med. 2005 Aug;34(7):436-43. doi: 10.1111/j.1600-0714.2005.00342.x.
• [31] Retinoic acid receptor- and retinoid X receptor-selective retinoids activate signaling pathways that converge on AP-1 and inhibit squamous differentiation in human bronchial epithelial cells. Cell Growth Differ. 1996 Aug;7(8):997-1004.
• [32] Correlation of chemopreventive efficacy data from the human epidermal cell assay with in vivo data. Anticancer Res. 2000 Jan-Feb;20(1A):27-32.
• [33] Deducing signaling pathways from parallel actions of arsenite and antimonite in human epidermal keratinocytes. Sci Rep. 2020 Feb 19;10(1):2890. doi: 10.1038/s41598-020-59577-0.
• [34] Beta-carotene and apocarotenals promote retinoid signaling in BEAS-2B human bronchioepithelial cells. Arch Biochem Biophys. 2006 Nov 1;455(1):48-60.
• [35] Proteomic analysis of the cellular response to a potent sensitiser unveils the dynamics of haptenation in living cells. Toxicology. 2020 Dec 1;445:152603. doi: 10.1016/j.tox.2020.152603. Epub 2020 Sep 28.
• [36] Curcumin suppresses AP1 transcription factor-dependent differentiation and activates apoptosis in human epidermal keratinocytes. J Biol Chem. 2007 Mar 2;282(9):6707-15. doi: 10.1074/jbc.M606003200. Epub 2006 Dec 5.
• [37] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [38] Activation of SOX2 expression by BRD4-NUT oncogenic fusion drives neoplastic transformation in NUT midline carcinoma. Cancer Res. 2014 Jun 15;74(12):3332-43. doi: 10.1158/0008-5472.CAN-13-2658. Epub 2014 Apr 15.
• [39] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [40] Effects of methyl paraben on skin keratinocytes. J Appl Toxicol. 2007 Jan-Feb;27(1):1-9. doi: 10.1002/jat.1176.
• [41] Arsenite suppression of involucrin transcription through AP1 promoter sites in cultured human keratinocytes. Toxicol Appl Pharmacol. 2010 Mar 15;243(3):275-82. doi: 10.1016/j.taap.2009.12.006. Epub 2009 Dec 16.
• [42] Arsenite suppresses Notch1 signaling in human keratinocytes. J Invest Dermatol. 2009 Jan;129(1):155-61. doi: 10.1038/jid.2008.207. Epub 2008 Jul 17.