Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT4X293M)

DOT Name	Beclin-1 (BECN1)
Synonyms	Coiled-coil myosin-like BCL2-interacting protein; Protein GT197
Gene Name	BECN1
UniProt ID	BECN1_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	2P1L; 2PON; 3DVU; 4DDP; 4MI8; 5EFM; 5HHE; 5VAU; 5VAX; 5VAY; 6DCN; 6DCO; 6HOI; 6HOJ; 6HOK; 7BL1; 8SOR; 8SRQ
Pfam ID	PF04111 ; PF17675 ; PF15285
Sequence	MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEE ETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTG DLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQL QMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQ LELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEW NEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFF WDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFN SEEQWTKALKFMLTNLKWGLAWVSSQFYNK
Function	Plays a central role in autophagy. Acts as a core subunit of the PI3K complex that mediates formation of phosphatidylinositol 3-phosphate; different complex forms are believed to play a role in multiple membrane trafficking pathways: PI3KC3-C1 is involved in initiation of autophagosomes and PI3KC3-C2 in maturation of autophagosomes and endocytosis. Involved in regulation of degradative endocytic trafficking and required for the abcission step in cytokinesis, probably in the context of PI3KC3-C2. Essential for the formation of PI3KC3-C2 but not PI3KC3-C1 PI3K complex forms. Involved in endocytosis. Protects against infection by a neurovirulent strain of Sindbis virus. May play a role in antiviral host defense; Beclin-1-C 35 kDa localized to mitochondria can promote apoptosis; it induces the mitochondrial translocation of BAX and the release of proapoptotic factors.
Tissue Specificity	Ubiquitous.
KEGG Pathway	Autophagy - other (hsa04136 ) Mitophagy - animal (hsa04137 ) Autophagy - animal (hsa04140 ) Apoptosis - multiple species (hsa04215 ) Apelin sig.ling pathway (hsa04371 ) Alzheimer disease (hsa05010 ) Amyotrophic lateral sclerosis (hsa05014 ) Huntington disease (hsa05016 ) Spinocerebellar ataxia (hsa05017 ) Pathways of neurodegeneration - multiple diseases (hsa05022 ) Shigellosis (hsa05131 ) Kaposi sarcoma-associated herpesvirus infection (hsa05167 )
Reactome Pathway	Macroautophagy (R-HSA-1632852 ) Ub-specific processing proteases (R-HSA-5689880 ) Translation of Replicase and Assembly of the Replication Transcription Complex (R-HSA-9679504 ) Translation of Replicase and Assembly of the Replication Transcription Complex (R-HSA-9694676 ) SARS-CoV-2 activates/modulates innate and adaptive immune responses (R-HSA-9705671 ) Antigen Presentation (R-HSA-983170 ) ISG15 antiviral mechanism (R-HSA-1169408 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Drug Response of 6 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Beclin-1 (BECN1) increases the response to substance of Cisplatin.	[67]
Bortezomib	DMNO38U	Approved	Beclin-1 (BECN1) decreases the response to substance of Bortezomib.	[68]
Paclitaxel	DMLB81S	Approved	Beclin-1 (BECN1) affects the response to substance of Paclitaxel.	[69]
Beta-lapachone	DMMI84K	Phase 2	Beclin-1 (BECN1) affects the response to substance of Beta-lapachone.	[70]
Staurosporine	DM0E9BR	Investigative	Beclin-1 (BECN1) decreases the response to substance of Staurosporine.	[71]
GOSSYPETIN	DMMT05U	Investigative	Beclin-1 (BECN1) increases the response to substance of GOSSYPETIN.	[72]
------------------------------------------------------------------------------------


⏷ Show the Full List of 6 Drug(s)

66 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of Beclin-1 (BECN1).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Beclin-1 (BECN1).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Beclin-1 (BECN1).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Beclin-1 (BECN1).	[4]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Beclin-1 (BECN1).	[7]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Beclin-1 (BECN1).	[8]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Beclin-1 (BECN1).	[9]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Beclin-1 (BECN1).	[10]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Beclin-1 (BECN1).	[11]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Beclin-1 (BECN1).	[12]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Beclin-1 (BECN1).	[13]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Beclin-1 (BECN1).	[14]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Beclin-1 (BECN1).	[15]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Beclin-1 (BECN1).	[16]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of Beclin-1 (BECN1).	[17]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone increases the expression of Beclin-1 (BECN1).	[18]
Ethanol	DMDRQZU	Approved	Ethanol increases the expression of Beclin-1 (BECN1).	[19]
DTI-015	DMXZRW0	Approved	DTI-015 decreases the expression of Beclin-1 (BECN1).	[20]
Menthol	DMG2KW7	Approved	Menthol increases the expression of Beclin-1 (BECN1).	[21]
Mitoxantrone	DMM39BF	Approved	Mitoxantrone decreases the expression of Beclin-1 (BECN1).	[22]
Methamphetamine	DMPM4SK	Approved	Methamphetamine increases the expression of Beclin-1 (BECN1).	[23]
Fluoxetine	DM3PD2C	Approved	Fluoxetine increases the expression of Beclin-1 (BECN1).	[24]
Imatinib	DM7RJXL	Approved	Imatinib increases the expression of Beclin-1 (BECN1).	[25]
Cholecalciferol	DMGU74E	Approved	Cholecalciferol increases the expression of Beclin-1 (BECN1).	[26]
Melatonin	DMKWFBT	Approved	Melatonin increases the expression of Beclin-1 (BECN1).	[27]
Morphine	DMRMS0L	Approved	Morphine increases the expression of Beclin-1 (BECN1).	[28]
Cantharidin	DMBP5N3	Approved	Cantharidin increases the expression of Beclin-1 (BECN1).	[29]
Amsacrine	DMZKYIV	Approved	Amsacrine increases the expression of Beclin-1 (BECN1).	[30]
Ropivacaine	DMSPJG2	Approved	Ropivacaine increases the expression of Beclin-1 (BECN1).	[31]
Calcipotriol	DM03CP7	Approved	Calcipotriol increases the expression of Beclin-1 (BECN1).	[32]
Benzocaine	DMI18HW	Approved	Benzocaine increases the expression of Beclin-1 (BECN1).	[33]
Maprotiline	DMPWB7T	Approved	Maprotiline increases the expression of Beclin-1 (BECN1).	[24]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Beclin-1 (BECN1).	[34]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate increases the expression of Beclin-1 (BECN1).	[35]
Curcumin	DMQPH29	Phase 3	Curcumin decreases the expression of Beclin-1 (BECN1).	[36]
Camptothecin	DM6CHNJ	Phase 3	Camptothecin increases the expression of Beclin-1 (BECN1).	[37]
Chloroquine	DMSI5CB	Phase 3 Trial	Chloroquine decreases the expression of Beclin-1 (BECN1).	[38]
Ym155	DM5Q1W4	Phase 2	Ym155 increases the expression of Beclin-1 (BECN1).	[39]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Beclin-1 (BECN1).	[40]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Beclin-1 (BECN1).	[41]
LY294002	DMY1AFS	Phase 1	LY294002 increases the expression of Beclin-1 (BECN1).	[40]
Tetrandrine	DMAOJBX	Phase 1	Tetrandrine decreases the expression of Beclin-1 (BECN1).	[42]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the expression of Beclin-1 (BECN1).	[43]
Flavonoid derivative 1	DMCQP0B	Patented	Flavonoid derivative 1 increases the expression of Beclin-1 (BECN1).	[44]
PMID26560530-Compound-35	DMO36RL	Patented	PMID26560530-Compound-35 increases the expression of Beclin-1 (BECN1).	[45]
Clioquinol	DM746BZ	Withdrawn from market	Clioquinol increases the expression of Beclin-1 (BECN1).	[46]
PF-1913539	DMXEU14	Discontinued in Phase 3	PF-1913539 increases the expression of Beclin-1 (BECN1).	[43]
EMBELIN	DMFZO4Y	Terminated	EMBELIN increases the expression of Beclin-1 (BECN1).	[47]
WIN-55212-2	DMACBIW	Terminated	WIN-55212-2 decreases the expression of Beclin-1 (BECN1).	[48]
L-709049	DMQZW6D	Terminated	L-709049 increases the expression of Beclin-1 (BECN1).	[49]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Beclin-1 (BECN1).	[50]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Beclin-1 (BECN1).	[51]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A increases the expression of Beclin-1 (BECN1).	[52]
Paraquat	DMR8O3X	Investigative	Paraquat increases the expression of Beclin-1 (BECN1).	[53]
Hexadecanoic acid	DMWUXDZ	Investigative	Hexadecanoic acid decreases the expression of Beclin-1 (BECN1).	[54]
Butanoic acid	DMTAJP7	Investigative	Butanoic acid increases the expression of Beclin-1 (BECN1).	[55]
Rapamycin Immunosuppressant Drug	DM678IB	Investigative	Rapamycin Immunosuppressant Drug increases the expression of Beclin-1 (BECN1).	[56]
Benzoquinone	DMNBA0G	Investigative	Benzoquinone increases the expression of Beclin-1 (BECN1).	[57]
Galangin	DM5TQ2O	Investigative	Galangin increases the expression of Beclin-1 (BECN1).	[58]
Dorsomorphin	DMKYXJW	Investigative	Dorsomorphin decreases the expression of Beclin-1 (BECN1).	[59]
OLEANOLIC_ACID	DMWDMJ3	Investigative	OLEANOLIC_ACID increases the expression of Beclin-1 (BECN1).	[61]
Syringic Acid	DM802V7	Investigative	Syringic Acid increases the expression of Beclin-1 (BECN1).	[62]
RHEIN	DMS6IJ0	Investigative	RHEIN decreases the expression of Beclin-1 (BECN1).	[63]
3-acetyl-11-keto-beta-boswellic acid	DMGO2D7	Investigative	3-acetyl-11-keto-beta-boswellic acid decreases the expression of Beclin-1 (BECN1).	[64]
Pyrovalerone	DMV48S2	Investigative	Pyrovalerone increases the expression of Beclin-1 (BECN1).	[65]
Thenoyltrifluoroacetone	DM54OKX	Investigative	Thenoyltrifluoroacetone increases the expression of Beclin-1 (BECN1).	[66]
------------------------------------------------------------------------------------


⏷ Show the Full List of 66 Drug(s)

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Estradiol	DMUNTE3	Approved	Estradiol affects the binding of Beclin-1 (BECN1).	[5]
------------------------------------------------------------------------------------

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Beclin-1 (BECN1).	[6]
PATULIN	DM0RV9C	Investigative	PATULIN increases the phosphorylation of Beclin-1 (BECN1).	[60]
------------------------------------------------------------------------------------

References

1	Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
2	Autophagy contributes to 4-Amino-2-Trifluoromethyl-Phenyl Retinate-induced differentiation in human acute promyelocytic leukemia NB4 cells. Toxicol Appl Pharmacol. 2017 Mar 15;319:1-11. doi: 10.1016/j.taap.2017.01.016. Epub 2017 Jan 25.
3	Interleukin 33 mediates hepatocyte autophagy and innate immune response in the early phase of acetaminophen-induced acute liver injury. Toxicology. 2021 May 30;456:152788. doi: 10.1016/j.tox.2021.152788. Epub 2021 Apr 19.
4	Resveratrol improves the anticancer effects of doxorubicin in vitro and in vivo models: a mechanistic insight. Phytomedicine. 2016 Mar 15;23(3):233-42.
5	The identification of cellular targets of 17 estradiol using a lytic (T7) cDNA phage display approach. Toxicol In Vitro. 2011 Feb;25(1):388-93. doi: 10.1016/j.tiv.2010.10.012. Epub 2010 Oct 27.
6	Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
7	Multitarget effects of quercetin in leukemia. Cancer Prev Res (Phila). 2014 Dec;7(12):1240-50. doi: 10.1158/1940-6207.CAPR-13-0383. Epub 2014 Oct 7.
8	Mechanism of thalidomide to enhance cytotoxicity of temozolomide in U251-MG glioma cells in vitro. Chin Med J (Engl). 2009 Jun 5;122(11):1260-6.
9	Antitumor effect of arsenic trioxide in human K562 and K562/ADM cells by autophagy. Toxicol Mech Methods. 2012 Sep;22(7):512-9. doi: 10.3109/15376516.2012.686534. Epub 2012 May 22.
10	Repression of Kisspeptin1 weakens hydrogen peroxide-caused injury in HTR8 cells via adjusting PI3K/AKT/mTOR pathway. J Biochem Mol Toxicol. 2020 May;34(5):e22461. doi: 10.1002/jbt.22461. Epub 2020 Feb 11.
11	Vitamin D3 induces autophagy in human monocytes/macrophages via cathelicidin. Cell Host Microbe. 2009 Sep 17;6(3):231-43. doi: 10.1016/j.chom.2009.08.004.
12	Autophagy induced by suberoylanilide hydroxamic acid in Hela S3 cells involves inhibition of protein kinase B and up-regulation of Beclin 1. Int J Biochem Cell Biol. 2008;40(2):272-83. doi: 10.1016/j.biocel.2007.07.020. Epub 2007 Aug 10.
13	Functional gene expression profile underlying methotrexate-induced senescence in human colon cancer cells. Tumour Biol. 2011 Oct;32(5):965-76.
14	Zoledronate dysregulates fatty acid metabolism in renal tubular epithelial cells to induce nephrotoxicity. Arch Toxicol. 2018 Jan;92(1):469-485.
15	Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
16	Cannabidiol enhances cytotoxicity of anti-cancer drugs in human head and neck squamous cell carcinoma. Sci Rep. 2020 Nov 26;10(1):20622. doi: 10.1038/s41598-020-77674-y.
17	Inhibition of autophagy enhances Hydroquinone-induced TK6 cell death. Toxicol In Vitro. 2017 Jun;41:123-132. doi: 10.1016/j.tiv.2017.02.024. Epub 2017 Mar 2.
18	Rosiglitazone induces autophagy in H295R and cell cycle deregulation in SW13 adrenocortical cancer cells. Exp Cell Res. 2011 Jun 10;317(10):1397-410. doi: 10.1016/j.yexcr.2011.02.014. Epub 2011 Mar 3.
19	Critical role of FoxO3a in alcohol-induced autophagy and hepatotoxicity. Am J Pathol. 2013 Dec;183(6):1815-1825. doi: 10.1016/j.ajpath.2013.08.011. Epub 2013 Oct 1.
20	Gene expression profile induced by BCNU in human glioma cell lines with differential MGMT expression. J Neurooncol. 2005 Jul;73(3):189-98.
21	Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
22	Autophagy (but not metabolism) is a key event in mitoxantrone-induced cytotoxicity in differentiated AC16 cardiac cells. Arch Toxicol. 2023 Jan;97(1):201-216. doi: 10.1007/s00204-022-03363-6. Epub 2022 Oct 10.
23	Involvement of C/EBP-related signaling pathway in methamphetamine-induced neuronal autophagy and apoptosis. Toxicol Lett. 2019 Sep 15;312:11-21. doi: 10.1016/j.toxlet.2019.05.003. Epub 2019 May 3.
24	The antidepressants maprotiline and fluoxetine induce Type II autophagic cell death in drug-resistant Burkitt's lymphoma. Int J Cancer. 2011 Apr 1;128(7):1712-23. doi: 10.1002/ijc.25477. Epub 2010 May 25.
25	Imatinib disturbs lysosomal function and morphology and impairs the activity of mTORC1 in human hepatocyte cell lines. Food Chem Toxicol. 2022 Apr;162:112869. doi: 10.1016/j.fct.2022.112869. Epub 2022 Feb 16.
26	Vitamin D3 induces autophagy of human myeloid leukemia cells. J Biol Chem. 2008 Sep 12;283(37):25596-25605. doi: 10.1074/jbc.M801716200. Epub 2008 Jul 15.
27	Melatonin attenuates cisplatin-induced HepG2 cell death via the regulation of mTOR and ERCC1 expressions. World J Hepatol. 2014 Apr 27;6(4):230-42. doi: 10.4254/wjh.v6.i4.230.
28	Morphine induces Beclin 1- and ATG5-dependent autophagy in human neuroblastoma SH-SY5Y cells and in the rat hippocampus. Autophagy. 2010 Apr;6(3):386-94. doi: 10.4161/auto.6.3.11289. Epub 2010 Apr 25.
29	Endoplasmic reticulum stress contributes to autophagy and apoptosis in cantharidin-induced nephrotoxicity. Food Chem Toxicol. 2022 May;163:112986. doi: 10.1016/j.fct.2022.112986. Epub 2022 Apr 6.
30	Amsacrine downregulates BCL2L1 expression and triggers apoptosis in human chronic myeloid leukemia cells through the SIDT2/NOX4/ERK/HuR pathway. Toxicol Appl Pharmacol. 2023 Sep 1;474:116625. doi: 10.1016/j.taap.2023.116625. Epub 2023 Jul 13.
31	Ropivacaine inhibits proliferation?and invasion?and promotes apoptosis and autophagy in bladder cancer cells via inhibiting PI3K/AKT pathway. J Biochem Mol Toxicol. 2023 Jan;37(1):e23233. doi: 10.1002/jbt.23233. Epub 2022 Oct 3.
32	Calcipotriol induces autophagy in HeLa cells and keratinocytes. J Invest Dermatol. 2011 Apr;131(4):990-3. doi: 10.1038/jid.2010.423. Epub 2011 Jan 13.
33	Nicotine-induced autophagy via AMPK/mTOR pathway exerts protective effect in colitis mouse model. Chem Biol Interact. 2020 Feb 1;317:108943. doi: 10.1016/j.cbi.2020.108943. Epub 2020 Jan 10.
34	Autophagic cell death induced by resveratrol depends on the Ca(2+)/AMPK/mTOR pathway in A549 cells. Biochem Pharmacol. 2013 Jul 15;86(2):317-28. doi: 10.1016/j.bcp.2013.05.003. Epub 2013 May 13.
35	Integrated transcriptomic and metabolomic analyses to characterize the anti-cancer effects of (-)-epigallocatechin-3-gallate in human colon cancer cells. Toxicol Appl Pharmacol. 2020 Aug 15;401:115100. doi: 10.1016/j.taap.2020.115100. Epub 2020 Jun 6.
36	Inhibition of ATF4-mediated elevation of both autophagy and AKT/mTOR was involved in antitumorigenic activity of curcumin. Food Chem Toxicol. 2023 Mar;173:113609. doi: 10.1016/j.fct.2023.113609. Epub 2023 Jan 12.
37	Camptothecin enhances c-Myc-mediated endoplasmic reticulum stress and leads to autophagy by activating Ca(2+)-mediated AMPK. Food Chem Toxicol. 2018 Nov;121:648-656. doi: 10.1016/j.fct.2018.09.057. Epub 2018 Sep 25.
38	Antitumor activity of chloroquine in combination with Cisplatin in human gastric cancer xenografts. Asian Pac J Cancer Prev. 2015;16(9):3907-12. doi: 10.7314/apjcp.2015.16.9.3907.
39	Autophagic HuR mRNA degradation induces survivin and MCL1 downregulation in YM155-treated human leukemia cells. Toxicol Appl Pharmacol. 2020 Jan 15;387:114857. doi: 10.1016/j.taap.2019.114857. Epub 2019 Dec 16.
40	Benzo[a]pyrene induces pyroptotic and autophagic death through inhibiting PI3K/Akt signaling pathway in HL-7702 human normal liver cells. J Toxicol Sci. 2019;44(2):121-131.
41	Targeting MYCN in neuroblastoma by BET bromodomain inhibition. Cancer Discov. 2013 Mar;3(3):308-23.
42	Tetrandrine induces apoptosis Via caspase-8, -9, and -3 and poly (ADP ribose) polymerase dependent pathways and autophagy through beclin-1/ LC3-I, II signaling pathways in human oral cancer HSC-3 cells. Environ Toxicol. 2016 Apr;31(4):395-406. doi: 10.1002/tox.22053. Epub 2014 Sep 30.
43	Caffeine Protects Skin from Oxidative Stress-Induced Senescence through the Activation of Autophagy. Theranostics. 2018 Nov 10;8(20):5713-5730. doi: 10.7150/thno.28778. eCollection 2018.
44	Antitumor activity of luteolin in human colon cancer SW620 cells is mediated by the ERK/FOXO3a signaling pathway. Toxicol In Vitro. 2020 Aug;66:104852. doi: 10.1016/j.tiv.2020.104852. Epub 2020 Apr 5.
45	Rottlerin induces autophagy which leads to apoptotic cell death through inhibition of PI3K/Akt/mTOR pathway in human pancreatic cancer stem cells. Biochem Pharmacol. 2012 Nov 1;84(9):1154-63. doi: 10.1016/j.bcp.2012.08.007. Epub 2012 Aug 15.
46	Clioquinol induces autophagy by down-regulation of calreticulin in human neurotypic SH-SY5Y cells. Chem Biol Interact. 2023 Jan 5;369:110268. doi: 10.1016/j.cbi.2022.110268. Epub 2022 Nov 15.
47	XIAP inhibitor embelin induces autophagic and apoptotic cell death in human oral squamous cell carcinoma cells. Environ Toxicol. 2017 Nov;32(11):2371-2378. doi: 10.1002/tox.22450. Epub 2017 Jul 19.
48	WIN55,212-2 induces caspase-independent apoptosis on human glioblastoma cells by regulating HSP70, p53 and Cathepsin D. Toxicol In Vitro. 2019 Jun;57:233-243. doi: 10.1016/j.tiv.2019.02.009. Epub 2019 Feb 15.
49	Nano-sized iron particles may induce multiple pathways of cell death following generation of mistranscripted RNA in human corneal epithelial cells. Toxicol In Vitro. 2017 Aug;42:348-357.
50	Astaxanthin Inhibits Autophagic Cell Death Induced by Bisphenol A in Human Dermal Fibroblasts. Antioxidants (Basel). 2021 Aug 11;10(8):1273. doi: 10.3390/antiox10081273.
51	Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
52	Ochratoxin A induces cytotoxicity through ROS-mediated endoplasmic reticulum stress pathway in human gastric epithelium cells. Toxicology. 2022 Sep;479:153309. doi: 10.1016/j.tox.2022.153309. Epub 2022 Sep 1.
53	[The effect of paraquat on autophagy in human embryonic neural progenitor cells]. Zhonghua Lao Dong Wei Sheng Zhi Ye Bing Za Zhi. 2016 Mar 20;34(3):178-83. doi: 10.3760/cma.j.issn.1001-9391.2016.03.005.
54	Trigonelline prevents high cholesterol and high fat diet induced hepatic lipid accumulation and lipo-toxicity in C57BL/6J mice, via restoration of hepatic autophagy. Food Chem Toxicol. 2018 Nov;121:283-296. doi: 10.1016/j.fct.2018.09.011. Epub 2018 Sep 9.
55	Sodium Butyrate Induces Endoplasmic Reticulum Stress and Autophagy in Colorectal Cells: Implications for Apoptosis. PLoS One. 2016 Jan 19;11(1):e0147218. doi: 10.1371/journal.pone.0147218. eCollection 2016.
56	MicroRNA-21 activation of ERK signaling via PTEN is involved in arsenite-induced autophagy in human hepatic L-02 cells. Toxicol Lett. 2016 Jun 11;252:1-10. doi: 10.1016/j.toxlet.2016.04.015. Epub 2016 Apr 20.
57	PINK1/Parkin-mediated mitophagy was activated against 1,4-Benzoquinone-induced apoptosis in HL-60 cells. Toxicol In Vitro. 2018 Aug;50:217-224. doi: 10.1016/j.tiv.2018.03.002. Epub 2018 Mar 20.
58	Galangin suppresses HepG2 cell proliferation by activating the TGF- receptor/Smad pathway. Toxicology. 2014 Dec 4;326:9-17. doi: 10.1016/j.tox.2014.09.010. Epub 2014 Sep 28.
59	-amanitin induces autophagy through AMPK-mTOR-ULK1 signaling pathway in hepatocytes. Toxicol Lett. 2023 Jul 1;383:89-97. doi: 10.1016/j.toxlet.2023.06.004. Epub 2023 Jun 16.
60	Patulin disrupts SLC7A11-cystine-cysteine-GSH antioxidant system and promotes renal cell ferroptosis both in vitro and in vivo. Food Chem Toxicol. 2022 Aug;166:113255. doi: 10.1016/j.fct.2022.113255. Epub 2022 Jun 27.
61	Oleanolic acid induces HCT116 colon cancer cell death through the p38/FOXO3a/Sirt6 pathway. Chem Biol Interact. 2022 Aug 25;363:110010. doi: 10.1016/j.cbi.2022.110010. Epub 2022 Jun 9.
62	In vitro and in vivo anticancer effects of syringic acid on colorectal cancer: Possible mechanistic view. Chem Biol Interact. 2021 Mar 1;337:109337. doi: 10.1016/j.cbi.2020.109337. Epub 2021 Feb 4.
63	Apoptotic effects of rhein through the mitochondrial pathways, two death receptor pathways, and reducing autophagy in human liver L02 cells. Environ Toxicol. 2019 Dec;34(12):1292-1302. doi: 10.1002/tox.22830. Epub 2019 Aug 21.
64	Acetyl-11-keto--boswellic acid enhances the cisplatin sensitivity of non-small cell lung cancer cells through cell cycle arrest, apoptosis induction, and autophagy suppression via p21-dependent signaling pathway. Cell Biol Toxicol. 2021 Apr;37(2):209-228. doi: 10.1007/s10565-020-09541-5. Epub 2020 Jun 20.
65	-Pyrrolidinononanophenone provokes apoptosis of neuronal cells through alterations in antioxidant properties. Toxicology. 2017 Jul 1;386:93-102. doi: 10.1016/j.tox.2017.05.017. Epub 2017 May 31.
66	Mitochondrial electron-transport-chain inhibitors of complexes I and II induce autophagic cell death mediated by reactive oxygen species. J Cell Sci. 2007 Dec 1;120(Pt 23):4155-66. doi: 10.1242/jcs.011163.
67	Nrf2 induces cisplatin resistance through activation of autophagy in ovarian carcinoma. Int J Clin Exp Pathol. 2014 Mar 15;7(4):1502-13. eCollection 2014.
68	Tumor cells can evade dependence on autophagy through adaptation. Biochem Biophys Res Commun. 2012 Aug 31;425(3):684-8. doi: 10.1016/j.bbrc.2012.07.090. Epub 2012 Jul 25.
69	The role of Caspase-1/GSDMD-mediated pyroptosis in Taxol-induced cell death and a Taxol-resistant phenotype in nasopharyngeal carcinoma regulated by autophagy. Cell Biol Toxicol. 2020 Oct;36(5):437-457. doi: 10.1007/s10565-020-09514-8. Epub 2020 Jan 28.
70	-Lapachone-induced reactive oxygen species (ROS) generation mediates autophagic cell death in glioma U87 MG cells. Chem Biol Interact. 2011 Jan 15;189(1-2):37-44. doi: 10.1016/j.cbi.2010.10.013. Epub 2010 Oct 28.
71	Rapamycin pre-treatment protects against apoptosis. Hum Mol Genet. 2006 Apr 1;15(7):1209-16. doi: 10.1093/hmg/ddl036. Epub 2006 Feb 23.
72	In Vitro and in Vivo Atheroprotective Effects of Gossypetin against Endothelial Cell Injury by Induction of Autophagy. Chem Res Toxicol. 2015 Feb 16;28(2):202-15. doi: 10.1021/tx5003518.