General Information of Drug Off-Target (DOT) (ID: OT59LSW7)

DOT Name ATP-dependent DNA helicase Q4 (RECQL4)
Synonyms EC 5.6.2.4; DNA 3'-5' helicase RecQ4; DNA helicase, RecQ-like type 4; RecQ4; RTS; RecQ protein-like 4
Gene Name RECQL4
Related Disease
Baller-Gerold syndrome ( )
Pancytopenia ( )
Rothmund-Thomson syndrome ( )
Rothmund-Thomson syndrome type 2 ( )
Adult glioblastoma ( )
Adult lymphoma ( )
Bloom syndrome ( )
Carcinoma ( )
Cervical cancer ( )
Cervical carcinoma ( )
Exanthem ( )
Gastric cancer ( )
Glioblastoma multiforme ( )
Glioma ( )
Herpes zoster ( )
Intellectual disability ( )
Laryngeal disorder ( )
leukaemia ( )
Leukemia ( )
Lung cancer ( )
Lung carcinoma ( )
Lymphoma ( )
Malaria ( )
Melanoma ( )
Meningitis ( )
Neoplasm ( )
Osteosarcoma ( )
Pediatric lymphoma ( )
Plasmodium falciparum malaria ( )
Prostate cancer ( )
Prostate carcinoma ( )
Rabies ( )
Rapadilino syndrome ( )
Retinoblastoma ( )
Rubinstein-Taybi syndrome ( )
Sleep apnea syndrome ( )
T-cell lymphoma ( )
Werner syndrome ( )
Breast cancer ( )
Breast carcinoma ( )
Craniosynostosis ( )
Fanconi anemia complementation group A ( )
Fanconi's anemia ( )
Li-Fraumeni syndrome ( )
Carcinoma of liver and intrahepatic biliary tract ( )
Cutaneous mastocytosis ( )
Hepatocellular carcinoma ( )
Liver cancer ( )
Pneumocystis pneumonia ( )
UniProt ID
RECQ4_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2KMU; 5LST
EC Number
5.6.2.4
Pfam ID
PF00270 ; PF11719 ; PF00271
Sequence
MERLRDVRERLQAWERAFRRQRGRRPSQDDVEAAPEETRALYREYRTLKRTTGQAGGGLR
SSESLPAAAEEAPEPRCWGPHLNRAATKSPQSTPGRSRQGSVPDYGQRLKANLKGTLQAG
PALGRRPWPLGRASSKASTPKPPGTGPVPSFAEKVSDEPPQLPEPQPRPGRLQHLQASLS
QRLGSLDPGWLQRCHSEVPDFLGAPKACRPDLGSEESQLLIPGESAVLGPGAGSQGPEAS
AFQEVSIRVGSPQPSSSGGEKRRWNEEPWESPAQVQQESSQAGPPSEGAGAVAVEEDPPG
EPVQAQPPQPCSSPSNPRYHGLSPSSQARAGKAEGTAPLHIFPRLARHDRGNYVRLNMKQ
KHYVRGRALRSRLLRKQAWKQKWRKKGECFGGGGATVTTKESCFLNEQFDHWAAQCPRPA
SEEDTDAVGPEPLVPSPQPVPEVPSLDPTVLPLYSLGPSGQLAETPAEVFQALEQLGHQA
FRPGQERAVMRILSGISTLLVLPTGAGKSLCYQLPALLYSRRSPCLTLVVSPLLSLMDDQ
VSGLPPCLKAACIHSGMTRKQRESVLQKIRAAQVHVLMLTPEALVGAGGLPPAAQLPPVA
FACIDEAHCLSQWSHNFRPCYLRVCKVLRERMGVHCFLGLTATATRRTASDVAQHLAVAE
EPDLHGPAPVPTNLHLSVSMDRDTDQALLTLLQGKRFQNLDSIIIYCNRREDTERIAALL
RTCLHAAWVPGSGGRAPKTTAEAYHAGMCSRERRRVQRAFMQGQLRVVVATVAFGMGLDR
PDVRAVLHLGLPPSFESYVQAVGRAGRDGQPAHCHLFLQPQGEDLRELRRHVHADSTDFL
AVKRLVQRVFPACTCTCTRPPSEQEGAVGGERPVPKYPPQEAEQLSHQAAPGPRRVCMGH
ERALPIQLTVQALDMPEEAIETLLCYLELHPHHWLELLATTYTHCRLNCPGGPAQLQALA
HRCPPLAVCLAQQLPEDPGQGSSSVEFDMVKLVDSMGWELASVRRALCQLQWDHEPRTGV
RRGTGVLVEFSELAFHLRSPGDLTAEEKDQICDFLYGRVQARERQALARLRRTFQAFHSV
AFPSCGPCLEQQDEERSTRLKDLLGRYFEEEEGQEPGGMEDAQGPEPGQARLQDWEDQVR
CDIRQFLSLRPEEKFSSRAVARIFHGIGSPCYPAQVYGQDRRFWRKYLHLSFHALVGLAT
EELLQVAR
Function
An ATP-dependent DNA helicase which unwinds dsDNA with a 3'-overhang in a 3'-5' direction. Does not unwind more than 18 bp of dsDNA. May modulate chromosome segregation. The N-terminal domain (residues 1-54) binds DNA Y-shaped DNA better than ss- or dsDNA. The core helicase domain binds ssDNA.
Tissue Specificity Ubiquitously expressed, with highest levels in thymus and testis.

Molecular Interaction Atlas (MIA) of This DOT

49 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Baller-Gerold syndrome DIS245AL Definitive Autosomal recessive [1]
Pancytopenia DISVKEHV Definitive Biomarker [2]
Rothmund-Thomson syndrome DISGVBCV Definitive Autosomal recessive [3]
Rothmund-Thomson syndrome type 2 DISK9SP2 Definitive Autosomal recessive [4]
Adult glioblastoma DISVP4LU Strong Biomarker [5]
Adult lymphoma DISK8IZR Strong Biomarker [6]
Bloom syndrome DISKXQ7J Strong Biomarker [7]
Carcinoma DISH9F1N Strong Biomarker [8]
Cervical cancer DISFSHPF Strong Altered Expression [9]
Cervical carcinoma DIST4S00 Strong Altered Expression [9]
Exanthem DISAFOQN Strong Genetic Variation [10]
Gastric cancer DISXGOUK Strong Altered Expression [11]
Glioblastoma multiforme DISK8246 Strong Biomarker [5]
Glioma DIS5RPEH Strong Biomarker [12]
Herpes zoster DISNSMNY Strong Biomarker [13]
Intellectual disability DISMBNXP Strong Biomarker [6]
Laryngeal disorder DISDKUQO Strong Biomarker [8]
leukaemia DISS7D1V Strong Biomarker [14]
Leukemia DISNAKFL Strong Biomarker [14]
Lung cancer DISCM4YA Strong Biomarker [15]
Lung carcinoma DISTR26C Strong Biomarker [15]
Lymphoma DISN6V4S Strong Biomarker [6]
Malaria DISQ9Y50 Strong Biomarker [16]
Melanoma DIS1RRCY Strong Biomarker [17]
Meningitis DISQABAA Strong Biomarker [18]
Neoplasm DISZKGEW Strong Altered Expression [19]
Osteosarcoma DISLQ7E2 Strong Autosomal recessive [20]
Pediatric lymphoma DIS51BK2 Strong Biomarker [6]
Plasmodium falciparum malaria DIS3Q9KF Strong Biomarker [21]
Prostate cancer DISF190Y Strong Genetic Variation [22]
Prostate carcinoma DISMJPLE Strong Genetic Variation [22]
Rabies DISSC4V5 Strong Biomarker [23]
Rapadilino syndrome DISJX57C Strong Autosomal recessive [20]
Retinoblastoma DISVPNPB Strong Biomarker [24]
Rubinstein-Taybi syndrome DISVF1HM Strong Genetic Variation [25]
Sleep apnea syndrome DISER6KS Strong Biomarker [26]
T-cell lymphoma DISSXRTQ Strong Genetic Variation [27]
Werner syndrome DISZY45W Strong Biomarker [7]
Breast cancer DIS7DPX1 moderate Genetic Variation [28]
Breast carcinoma DIS2UE88 moderate Biomarker [28]
Craniosynostosis DIS6J405 moderate Altered Expression [29]
Fanconi anemia complementation group A DIS8PZLI moderate Genetic Variation [30]
Fanconi's anemia DISGW6Q8 moderate Genetic Variation [30]
Li-Fraumeni syndrome DISR64XA Disputed Genetic Variation [31]
Carcinoma of liver and intrahepatic biliary tract DIS8WA0W Limited Altered Expression [19]
Cutaneous mastocytosis DISLBZEF Limited Biomarker [18]
Hepatocellular carcinoma DIS0J828 Limited Biomarker [19]
Liver cancer DISDE4BI Limited Altered Expression [19]
Pneumocystis pneumonia DISFSOM3 Limited Genetic Variation [32]
------------------------------------------------------------------------------------
⏷ Show the Full List of 49 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of ATP-dependent DNA helicase Q4 (RECQL4). [33]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the methylation of ATP-dependent DNA helicase Q4 (RECQL4). [34]
------------------------------------------------------------------------------------
12 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of ATP-dependent DNA helicase Q4 (RECQL4). [35]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of ATP-dependent DNA helicase Q4 (RECQL4). [36]
Quercetin DM3NC4M Approved Quercetin increases the expression of ATP-dependent DNA helicase Q4 (RECQL4). [37]
Calcitriol DM8ZVJ7 Approved Calcitriol decreases the expression of ATP-dependent DNA helicase Q4 (RECQL4). [38]
Testosterone DM7HUNW Approved Testosterone decreases the expression of ATP-dependent DNA helicase Q4 (RECQL4). [38]
Bortezomib DMNO38U Approved Bortezomib increases the expression of ATP-dependent DNA helicase Q4 (RECQL4). [39]
Troglitazone DM3VFPD Approved Troglitazone decreases the expression of ATP-dependent DNA helicase Q4 (RECQL4). [40]
Hydroquinone DM6AVR4 Approved Hydroquinone increases the expression of ATP-dependent DNA helicase Q4 (RECQL4). [41]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of ATP-dependent DNA helicase Q4 (RECQL4). [42]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of ATP-dependent DNA helicase Q4 (RECQL4). [43]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of ATP-dependent DNA helicase Q4 (RECQL4). [44]
Coumestrol DM40TBU Investigative Coumestrol increases the expression of ATP-dependent DNA helicase Q4 (RECQL4). [45]
------------------------------------------------------------------------------------
⏷ Show the Full List of 12 Drug(s)

References

1 Cloning of two new human helicase genes of the RecQ family: biological significance of multiple species in higher eukaryotes. Genomics. 1998 Dec 15;54(3):443-52. doi: 10.1006/geno.1998.5595.
2 ATP-dependent helicase activity is dispensable for the physiological functions of Recql4.PLoS Genet. 2019 Jul 5;15(7):e1008266. doi: 10.1371/journal.pgen.1008266. eCollection 2019 Jul.
3 Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
4 Rothmund-Thomson syndrome due to RECQ4 helicase mutations: report and clinical and molecular comparisons with Bloom syndrome and Werner syndrome. Am J Med Genet. 2000 Jan 31;90(3):223-8. doi: 10.1002/(sici)1096-8628(20000131)90:3<223::aid-ajmg7>3.0.co;2-z.
5 DNA-repair gene variants are associated with glioblastoma survival.Acta Oncol. 2012 Mar;51(3):325-32. doi: 10.3109/0284186X.2011.616284. Epub 2011 Oct 21.
6 Rothmund-Thomson syndrome and osteoma cutis in a patient previously diagnosed as COPS syndrome.Eur J Pediatr. 2017 Feb;176(2):279-283. doi: 10.1007/s00431-016-2834-3. Epub 2016 Dec 30.
7 Bloom's syndrome: Why not premature aging?: A comparison of the BLM and WRN helicases.Ageing Res Rev. 2017 Jan;33:36-51. doi: 10.1016/j.arr.2016.05.010. Epub 2016 May 26.
8 Deletions of N33, STK11 and TP53 are involved in the development of lymph node metastasis in larynx and pharynx carcinomas.Cell Oncol. 2007;29(4):327-34. doi: 10.1155/2007/635962.
9 Over expression of minichromosome maintenance genes is clinically correlated to cervical carcinogenesis.PLoS One. 2013 Jul 17;8(7):e69607. doi: 10.1371/journal.pone.0069607. Print 2013.
10 Defective sister-chromatid cohesion, aneuploidy and cancer predisposition in a mouse model of type II Rothmund-Thomson syndrome.Hum Mol Genet. 2005 Mar 15;14(6):813-25. doi: 10.1093/hmg/ddi075. Epub 2005 Feb 9.
11 Overexpression of RECQL4 is associated with poor prognosis in patients with gastric cancer.Oncol Lett. 2018 Oct;16(4):5419-5425. doi: 10.3892/ol.2018.9318. Epub 2018 Aug 17.
12 Regulated intratumoral expression of IL-12 using a RheoSwitch Therapeutic System() (RTS()) gene switch as gene therapy for the treatment of glioma.Cancer Gene Ther. 2018 Jun;25(5-6):106-116. doi: 10.1038/s41417-018-0019-0. Epub 2018 May 14.
13 Updated insights into the mechanism of action and clinical profile of the immunoadjuvant QS-21: A review.Phytomedicine. 2019 Jul;60:152905. doi: 10.1016/j.phymed.2019.152905. Epub 2019 Mar 30.
14 Realgar transforming solution as a novel arsenic agent with a lower risk of cardiotoxicity.J Pharmacol Sci. 2019 Jun;140(2):162-170. doi: 10.1016/j.jphs.2019.06.003. Epub 2019 Jun 15.
15 Variants in DNA double-strand break repair and DNA damage-response genes and susceptibility to lung and head and neck cancers.Int J Cancer. 2008 Jul 15;123(2):457-463. doi: 10.1002/ijc.23524.
16 Combining antimalarial drugs and vaccine for malaria elimination campaigns: a randomized safety and immunogenicity trial of RTS,S/AS01 administered with dihydroartemisinin, piperaquine, and primaquine in healthy Thai adult volunteers.Hum Vaccin Immunother. 2020;16(1):33-41. doi: 10.1080/21645515.2019.1643675. Epub 2019 Aug 15.
17 On the interplay of telomeres, nevi and the risk of melanoma.PLoS One. 2012;7(12):e52466. doi: 10.1371/journal.pone.0052466. Epub 2012 Dec 27.
18 Safety profile of the RTS,S/AS01 malaria vaccine in infants and children: additional data from a phase III randomized controlled trial in sub-Saharan Africa.Hum Vaccin Immunother. 2019;15(10):2386-2398. doi: 10.1080/21645515.2019.1586040. Epub 2019 Apr 23.
19 Upregulation of RECQL4 expression predicts poor prognosis in hepatocellular carcinoma.Oncol Lett. 2018 Apr;15(4):4248-4254. doi: 10.3892/ol.2018.7860. Epub 2018 Jan 25.
20 Association between osteosarcoma and deleterious mutations in the RECQL4 gene in Rothmund-Thomson syndrome. J Natl Cancer Inst. 2003 May 7;95(9):669-74. doi: 10.1093/jnci/95.9.669.
21 Immune response to the hepatitis B antigen in the RTS,S/AS01 malaria vaccine, and co-administration with pneumococcal conjugate and rotavirus vaccines in African children: A randomized controlled trial.Hum Vaccin Immunother. 2018 Jun 3;14(6):1489-1500. doi: 10.1080/21645515.2018.1442996. Epub 2018 Apr 13.
22 Targeted next generation sequencing identifies functionally deleterious germline mutations in novel genes in early-onset/familial prostate cancer.PLoS Genet. 2018 Apr 16;14(4):e1007355. doi: 10.1371/journal.pgen.1007355. eCollection 2018 Apr.
23 Safety and immunogenicity of the RTS,S/AS01 malaria vaccine in infants and children identified as HIV-infected during a randomized trial in sub-Saharan Africa.Vaccine. 2020 Jan 22;38(4):897-906. doi: 10.1016/j.vaccine.2019.10.077. Epub 2019 Nov 7.
24 Array comparative genomic hybridization in osteosarcoma.Methods Mol Biol. 2013;973:227-47. doi: 10.1007/978-1-62703-281-0_15.
25 Mosaic CREBBP mutation causes overlapping clinical features of Rubinstein-Taybi and Filippi syndromes.Eur J Hum Genet. 2016 Aug;24(9):1363-6. doi: 10.1038/ejhg.2016.14. Epub 2016 Mar 9.
26 Retinal vein occlusion and obstructive sleep apnea: a series of 114 patients.Acta Ophthalmol. 2018 Dec;96(8):e919-e925. doi: 10.1111/aos.13798. Epub 2018 Sep 6.
27 A patient with Baller-Gerold syndrome and midline NK/T lymphoma.Am J Med Genet A. 2009 Feb 15;149A(4):755-9. doi: 10.1002/ajmg.a.32736.
28 RECQL4 helicase has oncogenic potential in sporadic breast cancers.J Pathol. 2016 Mar;238(4):495-501. doi: 10.1002/path.4681. Epub 2016 Feb 2.
29 RECQL4 Regulates p53 Function In Vivo During Skeletogenesis.J Bone Miner Res. 2015 Jun;30(6):1077-89. doi: 10.1002/jbmr.2436.
30 Subependymal giant cell astrocytoma-like astrocytoma: a neoplasm with a distinct phenotype and frequent neurofibromatosis type-1-association.Mod Pathol. 2018 Dec;31(12):1787-1800. doi: 10.1038/s41379-018-0103-x. Epub 2018 Jul 4.
31 RECQL4 and p53 potentiate the activity of polymerase and maintain the integrity of the human mitochondrial genome.Carcinogenesis. 2014 Jan;35(1):34-45. doi: 10.1093/carcin/bgt315. Epub 2013 Sep 25.
32 Successful umbilical cord blood stem cell transplantation in a patient with Rothmund-Thomson syndrome and combined immunodeficiency.Clin Genet. 2006 Apr;69(4):337-43. doi: 10.1111/j.1399-0004.2006.00592.x.
33 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
34 Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
35 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
36 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
37 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
38 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
39 The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
40 Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
41 Survival of retinal pigment epithelium after exposure to prolonged oxidative injury: a detailed gene expression and cellular analysis. Invest Ophthalmol Vis Sci. 2004 Oct;45(10):3767-77.
42 Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
43 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
44 Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
45 Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.