Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT68OI2Y)

• DOT Name: Transformation/transcription domain-associated protein (TRRAP)
• Synonyms: 350/400 kDa PCAF-associated factor; PAF350/400; STAF40; Tra1 homolog
• Gene Name: TRRAP
• Related Disease:
  Complex neurodevelopmental disorder with or without congenital anomalies
  Developmental delay with or without dysmorphic facies and autism
  Prostate cancer
  Prostate carcinoma
  Adult lymphoma
  Autism
  Brain neoplasm
  Carcinoma of liver and intrahepatic biliary tract
  Ciliopathy
  Colon cancer
  Colon carcinoma
  Epithelial ovarian cancer
  Hepatocellular carcinoma
  Intellectual disability
  Isolated congenital microcephaly
  Liver cancer
  Lymphoma
  Melanoma
  Neoplasm
  Obsessive compulsive disorder
  Ovarian cancer
  Ovarian neoplasm
  Pediatric lymphoma
  Plasma cell myeloma
  Psychotic disorder
  Teratoma
  Autosomal dominant nonsyndromic hearing loss
  Follicular lymphoma
  Autosomal dominant cerebellar ataxia type II
  Hearing loss, autosomal dominant 75
  Schizophrenia
• UniProt ID: TRRAP_HUMAN
• PDB ID: 7KTR; 8H7G
• Pfam ID: PF02259 ; PF00454 ; PF20175 ; PF20206
• Sequence:
  MAFVATQGATVVDQTTLMKKYLQFVAALTDVNTPDETKLKMMQEVSENFENVTSSPQYST
  FLEHIIPRFLTFLQDGEVQFLQEKPAQQLRKLVLEIIHRIPTNEHLRPHTKNVLSVMFRF
  LETENEENVLICLRIIIELHKQFRPPITQEIHHFLDFVKQIYKELPKVVNRYFENPQVIP
  ENTVPPPEMVGMITTIAVKVNPEREDSETRTHSIIPRGSLSLKVLAELPIIVVLMYQLYK
  LNIHNVVAEFVPLIMNTIAIQVSAQARQHKLYNKELYADFIAAQIKTLSFLAYIIRIYQE
  LVTKYSQQMVKGMLQLLSNCPAETAHLRKELLIAAKHILTTELRNQFIPCMDKLFDESIL
  IGSGYTARETLRPLAYSTLADLVHHVRQHLPLSDLSLAVQLFAKNIDDESLPSSIQTMSC
  KLLLNLVDCIRSKSEQESGNGRDVLMRMLEVFVLKFHTIARYQLSAIFKKCKPQSELGAV
  EAALPGVPTAPAAPGPAPSPAPVPAPPPPPPPPPPATPVTPAPVPPFEKQGEKDKEDKQT
  FQVTDCRSLVKTLVCGVKTITWGITSCKAPGEAQFIPNKQLQPKETQIYIKLVKYAMQAL
  DIYQVQIAGNGQTYIRVANCQTVRMKEEKEVLEHFAGVFTMMNPLTFKEIFQTTVPYMVE
  RISKNYALQIVANSFLANPTTSALFATILVEYLLDRLPEMGSNVELSNLYLKLFKLVFGS
  VSLFAAENEQMLKPHLHKIVNSSMELAQTAKEPYNYFLLLRALFRSIGGGSHDLLYQEFL
  PLLPNLLQGLNMLQSGLHKQHMKDLFVELCLTVPVRLSSLLPYLPMLMDPLVSALNGSQT
  LVSQGLRTLELCVDNLQPDFLYDHIQPVRAELMQALWRTLRNPADSISHVAYRVLGKFGG
  SNRKMLKESQKLHYVVTEVQGPSITVEFSDCKASLQLPMEKAIETALDCLKSANTEPYYR
  RQAWEVIKCFLVAMMSLEDNKHALYQLLAHPNFTEKTIPNVIISHRYKAQDTPARKTFEQ
  ALTGAFMSAVIKDLRPSALPFVASLIRHYTMVAVAQQCGPFLLPCYQVGSQPSTAMFHSE
  ENGSKGMDPLVLIDAIAICMAYEEKELCKIGEVALAVIFDVASIILGSKERACQLPLFSY
  IVERLCACCYEQAWYAKLGGVVSIKFLMERLPLTWVLQNQQTFLKALLFVMMDLTGEVSN
  GAVAMAKTTLEQLLMRCATPLKDEERAEEIVAAQEKSFHHVTHDLVREVTSPNSTVRKQA
  MHSLQVLAQVTGKSVTVIMEPHKEVLQDMVPPKKHLLRHQPANAQIGLMEGNTFCTTLQP
  RLFTMDLNVVEHKVFYTELLNLCEAEDSALTKLPCYKSLPSLVPLRIAALNALAACNYLP
  QSREKIIAALFKALNSTNSELQEAGEACMRKFLEGATIEVDQIHTHMRPLLMMLGDYRSL
  TLNVVNRLTSVTRLFPNSFNDKFCDQMMQHLRKWMEVVVITHKGGQRSDGNESISECGRC
  PLSPFCQFEEMKICSAIINLFHLIPAAPQTLVKPLLEVVMKTERAMLIEAGSPFREPLIK
  FLTRHPSQTVELFMMEATLNDPQWSRMFMSFLKHKDARPLRDVLAANPNRFITLLLPGGA
  QTAVRPGSPSTSTMRLDLQFQAIKIISIIVKNDDSWLASQHSLVSQLRRVWVSENFQERH
  RKENMAATNWKEPKLLAYCLLNYCKRNYGDIELLFQLLRAFTGRFLCNMTFLKEYMEEEI
  PKNYSIAQKRALFFRFVDFNDPNFGDELKAKVLQHILNPAFLYSFEKGEGEQLLGPPNPE
  GDNPESITSVFITKVLDPEKQADMLDSLRIYLLQYATLLVEHAPHHIHDNNKNRNSKLRR
  LMTFAWPCLLSKACVDPACKYSGHLLLAHIIAKFAIHKKIVLQVFHSLLKAHAMEARAIV
  RQAMAILTPAVPARMEDGHQMLTHWTRKIIVEEGHTVPQLVHILHLIVQHFKVYYPVRHH
  LVQHMVSAMQRLGFTPSVTIEQRRLAVDLSEVVIKWELQRIKDQQPDSDMDPNSSGEGVN
  SVSSSIKRGLSVDSAQEVKRFRTATGAISAVFGRSQSLPGADSLLAKPIDKQHTDTVVNF
  LIRVACQVNDNTNTAGSPGEVLSRRCVNLLKTALRPDMWPKSELKLQWFDKLLMTVEQPN
  QVNYGNICTGLEVLSFLLTVLQSPAILSSFKPLQRGIAACMTCGNTKVLRAVHSLLSRLM
  SIFPTEPSTSSVASKYEELECLYAAVGKVIYEGLTNYEKATNANPSQLFGTLMILKSACS
  NNPSYIDRLISVFMRSLQKMVREHLNPQAASGSTEATSGTSELVMLSLELVKTRLAVMSM
  EMRKNFIQAILTSLIEKSPDAKILRAVVKIVEEWVKNNSPMAANQTPTLREKSILLVKMM
  TYIEKRFPEDLELNAQFLDLVNYVYRDETLSGSELTAKLEPAFLSGLRCAQPLIRAKFFE
  VFDNSMKRRVYERLLYVTCSQNWEAMGNHFWIKQCIELLLAVCEKSTPIGTSCQGAMLPS
  ITNVINLADSHDRAAFAMVTHVKQEPRERENSESKEEDVEIDIELAPGDQTSTPKTKELS
  EKDIGNQLHMLTNRHDKFLDTLREVKTGALLSAFVQLCHISTTLAEKTWVQLFPRLWKIL
  SDRQQHALAGEISPFLCSGSHQVQRDCQPSALNCFVEAMSQCVPPIPIRPCVLKYLGKTH
  NLWFRSTLMLEHQAFEKGLSLQIKPKQTTEFYEQESITPPQQEILDSLAELYSLLQEEDM
  WAGLWQKRCKYSETATAIAYEQHGFFEQAQESYEKAMDKAKKEHERSNASPAIFPEYQLW
  EDHWIRCSKELNQWEALTEYGQSKGHINPYLVLECAWRVSNWTAMKEALVQVEVSCPKEM
  AWKVNMYRGYLAICHPEEQQLSFIERLVEMASSLAIREWRRLPHVVSHVHTPLLQAAQQI
  IELQEAAQINAGLQPTNLGRNNSLHDMKTVVKTWRNRLPIVSDDLSHWSSIFMWRQHHYQ
  GKPTWSGMHSSSIVTAYENSSQHDPSSNNAMLGVHASASAIIQYGKIARKQGLVNVALDI
  LSRIHTIPTVPIVDCFQKIRQQVKCYLQLAGVMGKNECMQGLEVIESTNLKYFTKEMTAE
  FYALKGMFLAQINKSEEANKAFSAAVQMHDVLVKAWAMWGDYLENIFVKERQLHLGVSAI
  TCYLHACRHQNESKSRKYLAKVLWLLSFDDDKNTLADAVDKYCIGVPPIQWLAWIPQLLT
  CLVGSEGKLLLNLISQVGRVYPQAVYFPIRTLYLTLKIEQRERYKSDPGPIRATAPMWRC
  SRIMHMQRELHPTLLSSLEGIVDQMVWFRENWHEEVLRQLQQGLAKCYSVAFEKSGAVSD
  AKITPHTLNFVKKLVSTFGVGLENVSNVSTMFSSAASESLARRAQATAQDPVFQKLKGQF
  TTDFDFSVPGSMKLHNLISKLKKWIKILEAKTKQLPKFFLIEEKCRFLSNFSAQTAEVEI
  PGEFLMPKPTHYYIKIARFMPRVEIVQKHNTAARRLYIRGHNGKIYPYLVMNDACLTESR
  REERVLQLLRLLNPCLEKRKETTKRHLFFTVPRVVAVSPQMRLVEDNPSSLSLVEIYKQR
  CAKKGIEHDNPISRYYDRLATVQARGTQASHQVLRDILKEVQSNMVPRSMLKEWALHTFP
  NATDYWTFRKMFTIQLALIGFAEFVLHLNRLNPEMLQIAQDTGKLNVAYFRFDINDATGD
  LDANRPVPFRLTPNISEFLTTIGVSGPLTASMIAVARCFAQPNFKVDGILKTVLRDEIIA
  WHKKTQEDTSSPLSAAGQPENMDSQQLVSLVQKAVTAIMTRLHNLAQFEGGESKVNTLVA
  AANSLDNLCRMDPAWHPWL
• Function: Adapter protein, which is found in various multiprotein chromatin complexes with histone acetyltransferase activity (HAT), which gives a specific tag for epigenetic transcription activation. Component of the NuA4 histone acetyltransferase complex which is responsible for acetylation of nucleosomal histones H4 and H2A. Plays a central role in MYC transcription activation, and also participates in cell transformation by MYC. Required for p53/TP53-, E2F1- and E2F4-mediated transcription activation. Also involved in transcription activation mediated by the adenovirus E1A, a viral oncoprotein that deregulates transcription of key genes. Probably acts by linking transcription factors such as E1A, MYC or E2F1 to HAT complexes such as STAGA thereby allowing transcription activation. Probably not required in the steps following histone acetylation in processes of transcription activation. May be required for the mitotic checkpoint and normal cell cycle progression. Component of a SWR1-like complex that specifically mediates the removal of histone H2A.Z/H2AZ1 from the nucleosome. May play a role in the formation and maintenance of the auditory system.
• KEGG Pathway:
  ATP-dependent chromatin remodeling (hsa03082)
  Human T-cell leukemia virus 1 infection (hsa05166)
• Reactome Pathway:
  HATs acetylate histones (R-HSA-3214847)
  Ub-specific processing proteases (R-HSA-5689880)
  Formation of the beta-catenin (R-HSA-201722)

Molecular Interaction Atlas (MIA) of This DOT

31 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Complex neurodevelopmental disorder with or without congenital anomalies	DISG5D0C	Definitive	Autosomal dominant	[1]
Developmental delay with or without dysmorphic facies and autism	DISI3C78	Definitive	Autosomal dominant	[2]
Prostate cancer	DISF190Y	Definitive	Genetic Variation	[3]
Prostate carcinoma	DISMJPLE	Definitive	Genetic Variation	[3]
Adult lymphoma	DISK8IZR	Strong	Biomarker	[4]
Autism	DISV4V1Z	Strong	Biomarker	[5]
Brain neoplasm	DISY3EKS	Strong	Biomarker	[6]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Strong	Biomarker	[7]
Ciliopathy	DIS10G4I	Strong	Biomarker	[8]
Colon cancer	DISVC52G	Strong	Biomarker	[4]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[4]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[9]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[7]
Intellectual disability	DISMBNXP	Strong	Biomarker	[5]
Isolated congenital microcephaly	DISUXHZ6	Strong	Biomarker	[10]
Liver cancer	DISDE4BI	Strong	Biomarker	[7]
Lymphoma	DISN6V4S	Strong	Biomarker	[4]
Melanoma	DIS1RRCY	Strong	Biomarker	[11]
Neoplasm	DISZKGEW	Strong	Genetic Variation	[12]
Obsessive compulsive disorder	DIS1ZMM2	Strong	Genetic Variation	[10]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[9]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[9]
Pediatric lymphoma	DIS51BK2	Strong	Biomarker	[4]
Plasma cell myeloma	DIS0DFZ0	Strong	Altered Expression	[13]
Psychotic disorder	DIS4UQOT	Strong	Genetic Variation	[10]
Teratoma	DIS6ICY4	Strong	Altered Expression	[14]
Autosomal dominant nonsyndromic hearing loss	DISYC1G0	Supportive	Autosomal dominant	[15]
Follicular lymphoma	DISVEUR6	Disputed	Biomarker	[16]
Autosomal dominant cerebellar ataxia type II	DIS0PM39	Limited	Biomarker	[17]
Hearing loss, autosomal dominant 75	DIS2ACKN	Limited	Autosomal dominant	[18]
Schizophrenia	DISSRV2N	Limited	Biomarker	[19]

8 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Transformation/transcription domain-associated protein (TRRAP).	[20]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Transformation/transcription domain-associated protein (TRRAP).	[25]
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the methylation of Transformation/transcription domain-associated protein (TRRAP).	[30]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Transformation/transcription domain-associated protein (TRRAP).	[32]
TAK-243	DM4GKV2	Phase 1	TAK-243 decreases the sumoylation of Transformation/transcription domain-associated protein (TRRAP).	[33]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Transformation/transcription domain-associated protein (TRRAP).	[35]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Transformation/transcription domain-associated protein (TRRAP).	[30]
Coumarin	DM0N8ZM	Investigative	Coumarin decreases the phosphorylation of Transformation/transcription domain-associated protein (TRRAP).	[35]

13 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Transformation/transcription domain-associated protein (TRRAP).	[21]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Transformation/transcription domain-associated protein (TRRAP).	[22]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Transformation/transcription domain-associated protein (TRRAP).	[23]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Transformation/transcription domain-associated protein (TRRAP).	[24]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Transformation/transcription domain-associated protein (TRRAP).	[26]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Transformation/transcription domain-associated protein (TRRAP).	[27]
Selenium	DM25CGV	Approved	Selenium increases the expression of Transformation/transcription domain-associated protein (TRRAP).	[28]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Transformation/transcription domain-associated protein (TRRAP).	[29]
Bortezomib	DMNO38U	Approved	Bortezomib decreases the expression of Transformation/transcription domain-associated protein (TRRAP).	[31]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene decreases the expression of Transformation/transcription domain-associated protein (TRRAP).	[21]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Transformation/transcription domain-associated protein (TRRAP).	[34]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A decreases the expression of Transformation/transcription domain-associated protein (TRRAP).	[36]
Microcystin-LR	DMTMLRN	Investigative	Microcystin-LR increases the expression of Transformation/transcription domain-associated protein (TRRAP).	[37]

References

• [1] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [2] De novo gene mutations highlight patterns of genetic and neural complexity in schizophrenia. Nat Genet. 2012 Dec;44(12):1365-9. doi: 10.1038/ng.2446. Epub 2012 Oct 3.
• [3] Germline Variants of Prostate Cancer in Japanese Families.PLoS One. 2016 Oct 4;11(10):e0164233. doi: 10.1371/journal.pone.0164233. eCollection 2016.
• [4] TRRAP is essential for regulating the accumulation of mutant and wild-type p53 in lymphoma.Blood. 2018 Jun 21;131(25):2789-2802. doi: 10.1182/blood-2017-09-806679. Epub 2018 Apr 13.
• [5] Missense Variants in the Histone Acetyltransferase Complex Component Gene TRRAP Cause Autism and Syndromic Intellectual Disability. Am J Hum Genet. 2019 Mar 7;104(3):530-541. doi: 10.1016/j.ajhg.2019.01.010. Epub 2019 Feb 28.
• [6] An RNAi screen identifies TRRAP as a regulator of brain tumor-initiating cell differentiation.Cell Stem Cell. 2010 Jan 8;6(1):37-47. doi: 10.1016/j.stem.2009.11.002.
• [7] Depletion of TRRAP Induces p53-Independent Senescence in Liver Cancer by Down-Regulating Mitotic Genes.Hepatology. 2020 Jan;71(1):275-290. doi: 10.1002/hep.30807. Epub 2019 Aug 11.
• [8] TRRAP is a central regulator of human multiciliated cell formation.J Cell Biol. 2018 Jun 4;217(6):1941-1955. doi: 10.1083/jcb.201706106. Epub 2018 Mar 27.
• [9] TRRAP stimulates the tumorigenic potential of ovarian cancer stem cells.BMB Rep. 2018 Oct;51(10):514-519. doi: 10.5483/BMBRep.2018.51.10.042.
• [10] De novo variant of TRRAP in a patient with very early onset psychosis in the context of non-verbal learning disability and obsessive-compulsive disorder: a case report.BMC Med Genet. 2018 Nov 13;19(1):197. doi: 10.1186/s12881-018-0711-9.
• [11] Exome sequencing identifies GRIN2A as frequently mutated in melanoma.Nat Genet. 2011 May;43(5):442-6. doi: 10.1038/ng.810. Epub 2011 Apr 15.
• [12] Mutational landscape of penile squamous cell carcinoma in a Chinese population.Int J Cancer. 2019 Sep 1;145(5):1280-1289. doi: 10.1002/ijc.32373. Epub 2019 May 8.
• [13] A molecular compendium of genes expressed in multiple myeloma.Blood. 2002 Sep 15;100(6):2175-86. doi: 10.1182/blood-2002-01-0008.
• [14] Differentiation of spontaneously contracting cardiomyocytes from non-virally reprogrammed human amniotic fluid stem cells.PLoS One. 2017 May 17;12(5):e0177824. doi: 10.1371/journal.pone.0177824. eCollection 2017.
• [15] Novel TRRAP mutation causes autosomal dominant non-syndromic hearing loss. Clin Genet. 2019 Oct;96(4):300-308. doi: 10.1111/cge.13590. Epub 2019 Jul 10.
• [16] Identification of TRA-1-60-positive cells as a potent refractory population in follicular lymphomas.Cancer Sci. 2019 Jan;110(1):443-457. doi: 10.1111/cas.13870. Epub 2018 Dec 8.
• [17] Posttranslational modification of ataxin-7 at lysine 257 prevents autophagy-mediated turnover of an N-terminal caspase-7 cleavage fragment.J Neurosci. 2009 Dec 2;29(48):15134-44. doi: 10.1523/JNEUROSCI.4720-09.2009.
• [18] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [19] Nipped-A regulates the Drosophila circadian clock via histone deubiquitination.EMBO J. 2020 Jan 2;39(1):e101259. doi: 10.15252/embj.2018101259. Epub 2019 Sep 19.
• [20] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [21] Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
• [22] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [23] The thioxotriazole copper(II) complex A0 induces endoplasmic reticulum stress and paraptotic death in human cancer cells. J Biol Chem. 2009 Sep 4;284(36):24306-19.
• [24] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [25] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [26] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [27] Minimal peroxide exposure of neuronal cells induces multifaceted adaptive responses. PLoS One. 2010 Dec 17;5(12):e14352. doi: 10.1371/journal.pone.0014352.
• [28] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [29] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [30] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [31] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [32] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [33] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [34] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [35] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [36] Ochratoxin a lowers mRNA levels of genes encoding for key proteins of liver cell metabolism. Cancer Genomics Proteomics. 2008 Nov-Dec;5(6):319-32.
• [37] Gene expression network regulated by DNA methylation and microRNA during microcystin-leucine arginine induced malignant transformation in human hepatocyte L02 cells. Toxicol Lett. 2018 Jun 1;289:42-53. doi: 10.1016/j.toxlet.2018.03.003. Epub 2018 Mar 5.