Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT6J9LJR)

• DOT Name: Laminin subunit beta-1 (LAMB1)
• Synonyms: Laminin B1 chain; Laminin-1 subunit beta; Laminin-10 subunit beta; Laminin-12 subunit beta; Laminin-2 subunit beta; Laminin-6 subunit beta; Laminin-8 subunit beta
• Gene Name: LAMB1
• Related Disease:
  Neoplasm
  Adenocarcinoma
  Advanced cancer
  Autism
  Brain neoplasm
  Campomelic dysplasia
  Carcinoma
  Cobblestone lissencephaly without muscular or ocular involvement
  Coloboma
  Craniometaphyseal dysplasia, autosomal dominant
  Crohn disease
  Endometriosis
  Epilepsy
  Glioma
  Hepatocellular carcinoma
  Leiomyoma
  Pneumoconiosis
  Prostate neoplasm
  Ulcerative colitis
  Uterine fibroids
  Autism spectrum disorder
  Autoimmune disease
  Craniosynostosis
  Neurodevelopmental disorder
  Pervasive developmental disorder
  Pulmonary fibrosis
  Recessive X-linked ichthyosis
  Bethlem myopathy
  Colon adenocarcinoma
  Colorectal carcinoma
  Prostate cancer
  Prostate carcinoma
• UniProt ID: LAMB1_HUMAN
• PDB ID: 5XAU; 7CEC; 8DMK
• Pfam ID: PF00053 ; PF21199 ; PF00055
• Sequence:
  MGLLQLLAFSFLALCRARVRAQEPEFSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGLHK
  PEPYCIVSHLQEDKKCFICNSQDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVEN
  VTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDCEASFPGISTG
  PMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFVKL
  HTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGFNEEVEGMVHGHCMC
  RHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSISCHFDMAVYLATGNVSGG
  VCDDCQHNTMGRNCEQCKPFYYQHPERDIRDPNFCERCTCDPAGSQNEGICDSYTDFSTG
  LIAGQCRCKLNVEGEHCDVCKEGFYDLSSEDPFGCKSCACNPLGTIPGGNPCDSETGHCY
  CKRLVTGQHCDQCLPEHWGLSNDLDGCRPCDCDLGGALNNSCFAESGQCSCRPHMIGRQC
  NEVEPGYYFATLDHYLYEAEEANLGPGVSIVERQYIQDRIPSWTGAGFVRVPEGAYLEFF
  IDNIPYSMEYDILIRYEPQLPDHWEKAVITVQRPGRIPTSSRCGNTIPDDDNQVVSLSPG
  SRYVVLPRPVCFEKGTNYTVRLELPQYTSSDSDVESPYTLIDSLVLMPYCKSLDIFTVGG
  SGDGVVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALLHQTGLACECDPQGS
  LSSVCDPNGGQCQCRPNVVGRTCNRCAPGTFGFGPSGCKPCECHLQGSVNAFCNPVTGQC
  HCFQGVYARQCDRCLPGHWGFPSCQPCQCNGHADDCDPVTGECLNCQDYTMGHNCERCLA
  GYYGDPIIGSGDHCRPCPCPDGPDSGRQFARSCYQDPVTLQLACVCDPGYIGSRCDDCAS
  GYFGNPSEVGGSCQPCQCHNNIDTTDPEACDKETGRCLKCLYHTEGEHCQFCRFGYYGDA
  LQQDCRKCVCNYLGTVQEHCNGSDCQCDKATGQCLCLPNVIGQNCDRCAPNTWQLASGTG
  CDPCNCNAAHSFGPSCNEFTGQCQCMPGFGGRTCSECQELFWGDPDVECRACDCDPRGIE
  TPQCDQSTGQCVCVEGVEGPRCDKCTRGYSGVFPDCTPCHQCFALWDVIIAELTNRTHRF
  LEKAKALKISGVIGPYRETVDSVERKVSEIKDILAQSPAAEPLKNIGNLFEEAEKLIKDV
  TEMMAQVEVKLSDTTSQSNSTAKELDSLQTEAESLDNTVKELAEQLEFIKNSDIRGALDS
  ITKYFQMSLEAEERVNASTTEPNSTVEQSALMRDRVEDVMMERESQFKEKQEEQARLLDE
  LAGKLQSLDLSAAAEMTCGTPPGASCSETECGGPNCRTDEGERKCGGPGCGGLVTVAHNA
  WQKAMDLDQDVLSALAEVEQLSKMVSEAKLRADEAKQSAEDILLKTNATKEKMDKSNEEL
  RNLIKQIRNFLTQDSADLDSIEAVANEVLKMEMPSTPQQLQNLTEDIRERVESLSQVEVI
  LQHSAADIARAEMLLEEAKRASKSATDVKVTADMVKEALEEAEKAQVAAEKAIKQADEDI
  QGTQNLLTSIESETAASEETLFNASQRISELERNVEELKRKAAQNSGEAEYIEKVVYTVK
  QSAEDVKKTLDGELDEKYKKVENLIAKKTEESADARRKAEMLQNEAKTLLAQANSKLQLL
  KDLERKYEDNQRYLEDKAQELARLEGEVRSLLKDISQKVAVYSTCL
• Function: Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. Involved in the organization of the laminar architecture of cerebral cortex. It is probably required for the integrity of the basement membrane/glia limitans that serves as an anchor point for the endfeet of radial glial cells and as a physical barrier to migrating neurons. Radial glial cells play a central role in cerebral cortical development, where they act both as the proliferative unit of the cerebral cortex and a scaffold for neurons migrating toward the pial surface.
• KEGG Pathway:
  PI3K-Akt sig.ling pathway (hsa04151)
  Focal adhesion (hsa04510)
  ECM-receptor interaction (hsa04512)
  Toxoplasmosis (hsa05145)
  Amoebiasis (hsa05146)
  Human papillomavirus infection (hsa05165)
  Pathways in cancer (hsa05200)
  Small cell lung cancer (hsa05222)
• Reactome Pathway:
  Laminin interactions (R-HSA-3000157)
  Non-integrin membrane-ECM interactions (R-HSA-3000171)
  ECM proteoglycans (R-HSA-3000178)
  L1CAM interactions (R-HSA-373760)
  Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) (R-HSA-381426)
  MET activates PTK2 signaling (R-HSA-8874081)
  Post-translational protein phosphorylation (R-HSA-8957275)
  EGR2 and SOX10-mediated initiation of Schwann cell myelination (R-HSA-9619665)
  Degradation of the extracellular matrix (R-HSA-1474228)

Molecular Interaction Atlas (MIA) of This DOT

32 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Neoplasm	DISZKGEW	Definitive	Biomarker	[1]
Adenocarcinoma	DIS3IHTY	Strong	Biomarker	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Autism	DISV4V1Z	Strong	Genetic Variation	[4]
Brain neoplasm	DISY3EKS	Strong	Biomarker	[5]
Campomelic dysplasia	DISVTW53	Strong	Altered Expression	[6]
Carcinoma	DISH9F1N	Strong	Altered Expression	[2]
Cobblestone lissencephaly without muscular or ocular involvement	DIS74G5S	Strong	Autosomal recessive	[7]
Coloboma	DISP39N5	Strong	Biomarker	[8]
Craniometaphyseal dysplasia, autosomal dominant	DISU12OO	Strong	Altered Expression	[6]
Crohn disease	DIS2C5Q8	Strong	Biomarker	[9]
Endometriosis	DISX1AG8	Strong	Biomarker	[10]
Epilepsy	DISBB28L	Strong	Altered Expression	[11]
Glioma	DIS5RPEH	Strong	Altered Expression	[12]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[13]
Leiomyoma	DISLDDFN	Strong	Altered Expression	[14]
Pneumoconiosis	DISSJLBN	Strong	Genetic Variation	[15]
Prostate neoplasm	DISHDKGQ	Strong	Altered Expression	[16]
Ulcerative colitis	DIS8K27O	Strong	Biomarker	[9]
Uterine fibroids	DISBZRMJ	Strong	Altered Expression	[14]
Autism spectrum disorder	DISXK8NV	moderate	Genetic Variation	[4]
Autoimmune disease	DISORMTM	moderate	Biomarker	[17]
Craniosynostosis	DIS6J405	moderate	Genetic Variation	[18]
Neurodevelopmental disorder	DIS372XH	moderate	Altered Expression	[4]
Pervasive developmental disorder	DIS51975	moderate	Genetic Variation	[4]
Pulmonary fibrosis	DISQKVLA	moderate	Altered Expression	[15]
Recessive X-linked ichthyosis	DISZY56W	moderate	Biomarker	[19]
Bethlem myopathy	DISVF5K2	Limited	Altered Expression	[20]
Colon adenocarcinoma	DISDRE0J	Limited	Biomarker	[21]
Colorectal carcinoma	DIS5PYL0	Limited	Biomarker	[21]
Prostate cancer	DISF190Y	Limited	Biomarker	[1]
Prostate carcinoma	DISMJPLE	Limited	Genetic Variation	[22]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Mitoxantrone	DMM39BF	Approved	Laminin subunit beta-1 (LAMB1) affects the response to substance of Mitoxantrone.	[48]

26 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Laminin subunit beta-1 (LAMB1).	[23]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Laminin subunit beta-1 (LAMB1).	[24]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Laminin subunit beta-1 (LAMB1).	[25]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Laminin subunit beta-1 (LAMB1).	[26]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Laminin subunit beta-1 (LAMB1).	[27]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Laminin subunit beta-1 (LAMB1).	[28]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Laminin subunit beta-1 (LAMB1).	[29]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Laminin subunit beta-1 (LAMB1).	[31]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Laminin subunit beta-1 (LAMB1).	[32]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Laminin subunit beta-1 (LAMB1).	[33]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Laminin subunit beta-1 (LAMB1).	[34]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Laminin subunit beta-1 (LAMB1).	[35]
Nicotine	DMWX5CO	Approved	Nicotine increases the expression of Laminin subunit beta-1 (LAMB1).	[36]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate decreases the expression of Laminin subunit beta-1 (LAMB1).	[37]
Dasatinib	DMJV2EK	Approved	Dasatinib increases the expression of Laminin subunit beta-1 (LAMB1).	[38]
Cocaine	DMSOX7I	Approved	Cocaine increases the expression of Laminin subunit beta-1 (LAMB1).	[39]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Laminin subunit beta-1 (LAMB1).	[40]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Laminin subunit beta-1 (LAMB1).	[41]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Laminin subunit beta-1 (LAMB1).	[42]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the expression of Laminin subunit beta-1 (LAMB1).	[43]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of Laminin subunit beta-1 (LAMB1).	[44]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Laminin subunit beta-1 (LAMB1).	[45]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Laminin subunit beta-1 (LAMB1).	[46]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A decreases the expression of Laminin subunit beta-1 (LAMB1).	[40]
Bilirubin	DMI0V4O	Investigative	Bilirubin decreases the expression of Laminin subunit beta-1 (LAMB1).	[47]
Methyl Mercury Ion	DM6YEW4	Investigative	Methyl Mercury Ion decreases the expression of Laminin subunit beta-1 (LAMB1).	[40]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Laminin subunit beta-1 (LAMB1).	[30]

References

• [1] Androgen-Induced TMPRSS2 Activates Matriptase and Promotes Extracellular Matrix Degradation, Prostate Cancer Cell Invasion, Tumor Growth, and Metastasis.Cancer Res. 2015 Jul 15;75(14):2949-60. doi: 10.1158/0008-5472.CAN-14-3297. Epub 2015 May 27.
• [2] Genes of laminin B1 chain, alpha 1 (IV) chain of type IV collagen, and 72-kd type IV collagenase are mainly expressed by the stromal cells of lung carcinomas.Am J Pathol. 1993 May;142(5):1622-30.
• [3] Intestinal and diffuse gastric cancers arise in a different background of Helicobacter pylori gastritis through different gene involvement.Am J Surg Pathol. 1996;20 Suppl 1:S8-22. doi: 10.1097/00000478-199600001-00003.
• [4] LAMB1 polymorphism is associated with autism symptom severity in Korean autism spectrum disorder patients.Nord J Psychiatry. 2015;69(8):594-8. doi: 10.3109/08039488.2015.1022597. Epub 2015 Mar 16.
• [5] Changes in laminin isoforms associated with brain tumor invasion and angiogenesis.Front Biosci. 2006 Jan 1;11:81-8. doi: 10.2741/1781.
• [6] Expression of laminin chains in skin in merosin-deficient congenital muscular dystrophy.Neuropediatrics. 1997 Aug;28(4):217-22. doi: 10.1055/s-2007-973703.
• [7] The Gene Curation Coalition: A global effort to harmonize gene-disease evidence resources. Genet Med. 2022 Aug;24(8):1732-1742. doi: 10.1016/j.gim.2022.04.017. Epub 2022 May 4.
• [8] Translational bypass of nonsense mutations in zebrafish rep1, pax2.1 and lamb1 highlights a viable therapeutic option for untreatable genetic eye disease.Hum Mol Genet. 2008 Dec 15;17(24):3987-4000. doi: 10.1093/hmg/ddn302. Epub 2008 Sep 22.
• [9] Genetic determinants associated with early age of diagnosis of IBD.Dis Colon Rectum. 2015 Mar;58(3):321-7. doi: 10.1097/DCR.0000000000000274.
• [10] Molecular evidence for differences in endometrium in severe versus mild endometriosis.Reprod Sci. 2011 Mar;18(3):229-51. doi: 10.1177/1933719110386241. Epub 2010 Nov 9.
• [11] Expression of laminin beta1 in hippocampi of patients with intractable epilepsy.Neurosci Lett. 2008 Oct 10;443(3):160-4. doi: 10.1016/j.neulet.2008.07.080. Epub 2008 Aug 5.
• [12] MiR-124-5p inhibits the growth of high-grade gliomas through posttranscriptional regulation of LAMB1.Neuro Oncol. 2014 May;16(5):637-51. doi: 10.1093/neuonc/not300. Epub 2014 Feb 3.
• [13] The PDGFR-laminin B1-keratin 19 cascade drives tumor progression at the invasive front of human hepatocellular carcinoma.Oncogene. 2017 Nov 23;36(47):6605-6616. doi: 10.1038/onc.2017.260. Epub 2017 Aug 7.
• [14] Genes associated with the genesis of leiomyoma of the uterus in a commonly deleted chromosomal region at 7q22.Oncol Rep. 2005 Mar;13(3):469-72.
• [15] The association of LAMB1 polymorphism and expression changes with the risk of coal workers' pneumoconiosis.Environ Toxicol. 2017 Sep;32(9):2182-2190. doi: 10.1002/tox.22431. Epub 2017 Apr 26.
• [16] Membrane type 1 matrix metalloprotease cleaves laminin-10 and promotes prostate cancer cell migration.Neoplasia. 2005 Apr;7(4):380-9. doi: 10.1593/neo.04619.
• [17] Salmonella SiiE prevents an efficient humoral immune memory by interfering with IgG(+) plasma cell persistence in the bone marrow.Proc Natl Acad Sci U S A. 2019 Apr 9;116(15):7425-7430. doi: 10.1073/pnas.1818242116. Epub 2019 Mar 25.
• [18] Lack of additional effects of long-term, low-dose clarithromycin combined treatment compared with topical steroids alone for chronic rhinosinusitis in China: a randomized, controlled trial.Int Forum Allergy Rhinol. 2018 Jan;8(1):8-14. doi: 10.1002/alr.22041. Epub 2017 Nov 30.
• [19] Novel drug candidate for the treatment of several softtissue sarcoma histologic subtypes: A computational method using survivalassociated gene signatures for drug repurposing.Oncol Rep. 2019 Apr;41(4):2241-2253. doi: 10.3892/or.2019.7033. Epub 2019 Feb 26.
• [20] Decreased expression of laminin beta 1 in chromosome 21-linked Bethlem myopathy.Neuromuscul Disord. 1999 Jul;9(5):326-9. doi: 10.1016/s0960-8966(99)00022-x.
• [21] Next Generation Proteomics for Clinical Biomarker Detection Using SWATH-MS.Methods Mol Biol. 2019;1977:3-15. doi: 10.1007/978-1-4939-9232-4_1.
• [22] Radiogenomics Consortium Genome-Wide Association Study Meta-Analysis of Late Toxicity After Prostate Cancer Radiotherapy.J Natl Cancer Inst. 2020 Feb 1;112(2):179-190. doi: 10.1093/jnci/djz075.
• [23] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [24] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [25] Constitutive gene expression predisposes morphogen-mediated cell fate responses of NT2/D1 and 27X-1 human embryonal carcinoma cells. Stem Cells. 2007 Mar;25(3):771-8. doi: 10.1634/stemcells.2006-0271. Epub 2006 Nov 30.
• [26] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [27] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [28] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [29] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [30] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [31] Minimal peroxide exposure of neuronal cells induces multifaceted adaptive responses. PLoS One. 2010 Dec 17;5(12):e14352. doi: 10.1371/journal.pone.0014352.
• [32] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [33] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [34] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [35] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [36] Nicotinic modulation of gene expression in SH-SY5Y neuroblastoma cells. Brain Res. 2006 Oct 20;1116(1):39-49.
• [37] CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
• [38] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [39] Gene expression in human hippocampus from cocaine abusers identifies genes which regulate extracellular matrix remodeling. PLoS One. 2007 Nov 14;2(11):e1187. doi: 10.1371/journal.pone.0001187.
• [40] Inhibition of CXCL12-mediated chemotaxis of Jurkat cells by direct immunotoxicants. Arch Toxicol. 2016 Jul;90(7):1685-94. doi: 10.1007/s00204-015-1585-7. Epub 2015 Aug 28.
• [41] The BET bromodomain inhibitor JQ1 suppresses growth of pancreatic ductal adenocarcinoma in patient-derived xenograft models. Oncogene. 2016 Feb 18;35(7):833-45.
• [42] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [43] Comparative proteomics reveals concordant and discordant biochemical effects of caffeine versus epigallocatechin-3-gallate in human endothelial cells. Toxicol Appl Pharmacol. 2019 Sep 1;378:114621. doi: 10.1016/j.taap.2019.114621. Epub 2019 Jun 10.
• [44] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [45] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [46] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [47] Global changes in gene regulation demonstrate that unconjugated bilirubin is able to upregulate and activate select components of the endoplasmic reticulum stress response pathway. J Biochem Mol Toxicol. 2010 Mar-Apr;24(2):73-88.
• [48] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.