Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT7I7KHC)

DOT Name Complement C1q tumor necrosis factor-related protein 1 (C1QTNF1)
Synonyms G protein-coupled receptor-interacting protein; GIP
Gene Name C1QTNF1
Related Disease
Arteriosclerosis ( )
Atherosclerosis ( )
Cardiac failure ( )
Cholestasis ( )
Congestive heart failure ( )
Coronary atherosclerosis ( )
High blood pressure ( )
Non-insulin dependent diabetes ( )
Obesity ( )
Vasculitis ( )
Chronic kidney disease ( )
Nephropathy ( )
Vascular disease ( )
Adult glioblastoma ( )
Glioblastoma multiforme ( )
Coronary heart disease ( )
Non-alcoholic fatty liver disease ( )
UniProt ID
C1QT1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00386 ; PF01391
Sequence
MGSRGQGLLLAYCLLLAFASGLVLSRVPHVQGEQQEWEGTEELPSPPDHAERAEEQHEKY
RPSQDQGLPASRCLRCCDPGTSMYPATAVPQINITILKGEKGDRGDRGLQGKYGKTGSAG
ARGHTGPKGQKGSMGAPGERCKSHYAAFSVGRKKPMHSNHYYQTVIFDTEFVNLYDHFNM
FTGKFYCYVPGLYFFSLNVHTWNQKETYLHIMKNEEEVVILFAQVGDRSIMQSQSLMLEL
REQDQVWVRLYKGERENAIFSEELDTYITFSGYLVKHATEP

Molecular Interaction Atlas (MIA) of This DOT

17 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Arteriosclerosis DISK5QGC Strong Biomarker [1]
Atherosclerosis DISMN9J3 Strong Biomarker [1]
Cardiac failure DISDC067 Strong Biomarker [2]
Cholestasis DISDJJWE Strong Biomarker [3]
Congestive heart failure DIS32MEA Strong Biomarker [2]
Coronary atherosclerosis DISKNDYU Strong Altered Expression [4]
High blood pressure DISY2OHH Strong Biomarker [5]
Non-insulin dependent diabetes DISK1O5Z Strong Biomarker [6]
Obesity DIS47Y1K Strong Biomarker [7]
Vasculitis DISQRKDX Strong Altered Expression [8]
Chronic kidney disease DISW82R7 moderate Altered Expression [7]
Nephropathy DISXWP4P moderate Altered Expression [7]
Vascular disease DISVS67S moderate Biomarker [7]
Adult glioblastoma DISVP4LU Disputed Biomarker [9]
Glioblastoma multiforme DISK8246 Disputed Genetic Variation [9]
Coronary heart disease DIS5OIP1 Limited Altered Expression [10]
Non-alcoholic fatty liver disease DISDG1NL Limited Altered Expression [10]
------------------------------------------------------------------------------------
⏷ Show the Full List of 17 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Complement C1q tumor necrosis factor-related protein 1 (C1QTNF1). [11]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Complement C1q tumor necrosis factor-related protein 1 (C1QTNF1). [17]
------------------------------------------------------------------------------------
7 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Complement C1q tumor necrosis factor-related protein 1 (C1QTNF1). [12]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Complement C1q tumor necrosis factor-related protein 1 (C1QTNF1). [13]
Zoledronate DMIXC7G Approved Zoledronate increases the expression of Complement C1q tumor necrosis factor-related protein 1 (C1QTNF1). [14]
Folic acid DMEMBJC Approved Folic acid decreases the expression of Complement C1q tumor necrosis factor-related protein 1 (C1QTNF1). [15]
Permethrin DMZ0Q1G Approved Permethrin increases the expression of Complement C1q tumor necrosis factor-related protein 1 (C1QTNF1). [16]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Complement C1q tumor necrosis factor-related protein 1 (C1QTNF1). [18]
Sulforaphane DMQY3L0 Investigative Sulforaphane decreases the expression of Complement C1q tumor necrosis factor-related protein 1 (C1QTNF1). [19]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Drug(s)

References

1 C1q/TNF-related protein 1 promotes endothelial barrier dysfunction under disturbed flow.Biochem Biophys Res Commun. 2017 Aug 19;490(2):580-586. doi: 10.1016/j.bbrc.2017.06.081. Epub 2017 Jun 15.
2 C1QTNF1 attenuates angiotensin II-induced cardiac hypertrophy via activation of the AMPKa pathway.Free Radic Biol Med. 2018 Jun;121:215-230. doi: 10.1016/j.freeradbiomed.2018.05.004. Epub 2018 May 5.
3 Elevated CTRP1 Plasma Concentration Is Associated with Sepsis and Pre-Existing Type 2 Diabetes Mellitus in Critically Ill Patients.J Clin Med. 2019 May 11;8(5):661. doi: 10.3390/jcm8050661.
4 Association of C1q/TNF-related protein-1 (CTRP1) serum levels with coronary artery disease.J Int Med Res. 2019 Jun;47(6):2571-2579. doi: 10.1177/0300060519847372. Epub 2019 May 13.
5 A novel blood pressure modulator C1q/TNF--related protein 1 (CTRP1).BMB Rep. 2018 Dec;51(12):611-612. doi: 10.5483/BMBRep.2018.51.12.268.
6 Circulating C1q complement/TNF-related protein (CTRP) 1, CTRP9, CTRP12 and CTRP13 concentrations in Type 2 diabetes mellitus: In vivo regulation by glucose.PLoS One. 2017 Feb 16;12(2):e0172271. doi: 10.1371/journal.pone.0172271. eCollection 2017.
7 Obesity and chronic kidney disease progression-the role of a new adipocytokine: C1q/tumour necrosis factor-related protein-1.Clin Kidney J. 2018 Oct 11;12(3):420-426. doi: 10.1093/ckj/sfy095. eCollection 2019 Jun.
8 Serum levels of C1q/tumor necrosis factor-related protein-1 in children with Kawasaki disease.Pediatr Res. 2018 May;83(5):999-1003. doi: 10.1038/pr.2018.16. Epub 2018 May 9.
9 Identification of CTRP1 as a Prognostic Biomarker and Oncogene in Human Glioblastoma.Biomed Res Int. 2019 Apr 30;2019:2582416. doi: 10.1155/2019/2582416. eCollection 2019.
10 The novel adipokine CTRP1 is significantly associated with the incidence of major adverse cardiovascular events.Atherosclerosis. 2019 Jul;286:1-6. doi: 10.1016/j.atherosclerosis.2019.04.222. Epub 2019 Apr 20.
11 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
12 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
13 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
14 Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
15 Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
16 Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
17 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
18 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
19 Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.