Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT7T8H6A)

• DOT Name: Bcl-2-associated transcription factor 1 (BCLAF1)
• Synonyms: Btf; BCLAF1 and THRAP3 family member 1
• Gene Name: BCLAF1
• Related Disease:
  Acute monocytic leukemia
  Acute myelogenous leukaemia
  B-cell lymphoma
  Bladder cancer
  Cytomegalovirus infection
  Herpes simplex infection
  Irritable bowel syndrome
  Neoplasm
  Non-hodgkin lymphoma
  Urinary bladder cancer
  Urinary bladder neoplasm
  Hepatocellular carcinoma
  Small-cell lung cancer
  Emery-Dreifuss muscular dystrophy
• UniProt ID: BCLF1_HUMAN
• PDB ID: 7RJN; 7RJR
• Pfam ID: PF15440
• Sequence:
  MGRSNSRSHSSRSKSRSQSSSRSRSRSHSRKKRYSSRSRSRTYSRSRSRDRMYSRDYRRD
  YRNNRGMRRPYGYRGRGRGYYQGGGGRYHRGGYRPVWNRRHSRSPRRGRSRSRSPKRRSV
  SSQRSRSRSRRSYRSSRSPRSSSSRSSSPYSKSPVSKRRGSQEKQTKKAEGEPQEESPLK
  SKSQEEPKDTFEHDPSESIDEFNKSSATSGDIWPGLSAYDNSPRSPHSPSPIATPPSQSS
  SCSDAPMLSTVHSAKNTPSQHSHSIQHSPERSGSGSVGNGSSRYSPSQNSPIHHIPSRRS
  PAKTIAPQNAPRDESRGRSSFYPDGGDQETAKTGKFLKRFTDEESRVFLLDRGNTRDKEA
  SKEKGSEKGRAEGEWEDQEALDYFSDKESGKQKFNDSEGDDTEETEDYRQFRKSVLADQG
  KSFATASHRNTEEEGLKYKSKVSLKGNRESDGFREEKNYKLKETGYVVERPSTTKDKHKE
  EDKNSERITVKKETQSPEQVKSEKLKDLFDYSPPLHKNLDAREKSTFREESPLRIKMIAS
  DSHRPEVKLKMAPVPLDDSNRPASLTKDRLLASTLVHSVKKEQEFRSIFDHIKLPQASKS
  TSESFIQHIVSLVHHVKEQYFKSAAMTLNERFTSYQKATEEHSTRQKSPEIHRRIDISPS
  TLRKHTRLAGEERVFKEENQKGDKKLRCDSADLRHDIDRRRKERSKERGDSKGSRESSGS
  RKQEKTPKDYKEYKSYKDDSKHKREQDHSRSSSSSASPSSPSSREEKESKKEREEEFKTH
  HEMKEYSGFAGVSRPRGTFFRIRGRGRARGVFAGTNTGPNNSNTTFQKRPKEEEWDPEYT
  PKSKKYFLHDDRDDGVDYWAKRGRGRGTFQRGRGRFNFKKSGSSPKWTHDKYQGDGIVED
  EEETMENNEEKKDRRKEEKE
• Function: Death-promoting transcriptional repressor. May be involved in cyclin-D1/CCND1 mRNA stability through the SNARP complex which associates with both the 3'end of the CCND1 gene and its mRNA.
• Tissue Specificity: Ubiquitous.

Molecular Interaction Atlas (MIA) of This DOT

14 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acute monocytic leukemia	DIS28NEL	Strong	Biomarker	[1]
Acute myelogenous leukaemia	DISCSPTN	Strong	Biomarker	[1]
B-cell lymphoma	DISIH1YQ	Strong	Biomarker	[2]
Bladder cancer	DISUHNM0	Strong	Biomarker	[3]
Cytomegalovirus infection	DISCEMGC	Strong	Biomarker	[4]
Herpes simplex infection	DISL1SAV	Strong	Biomarker	[5]
Irritable bowel syndrome	DIS27206	Strong	Altered Expression	[6]
Neoplasm	DISZKGEW	Strong	Biomarker	[7]
Non-hodgkin lymphoma	DISS2Y8A	Strong	Genetic Variation	[8]
Urinary bladder cancer	DISDV4T7	Strong	Biomarker	[3]
Urinary bladder neoplasm	DIS7HACE	Strong	Biomarker	[3]
Hepatocellular carcinoma	DIS0J828	moderate	Biomarker	[7]
Small-cell lung cancer	DISK3LZD	moderate	Biomarker	[9]
Emery-Dreifuss muscular dystrophy	DISYTPR5	Limited	Biomarker	[10]

27 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Bcl-2-associated transcription factor 1 (BCLAF1).	[11]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Bcl-2-associated transcription factor 1 (BCLAF1).	[12]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Bcl-2-associated transcription factor 1 (BCLAF1).	[13]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Bcl-2-associated transcription factor 1 (BCLAF1).	[14]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Bcl-2-associated transcription factor 1 (BCLAF1).	[15]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Bcl-2-associated transcription factor 1 (BCLAF1).	[16]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Bcl-2-associated transcription factor 1 (BCLAF1).	[18]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Bcl-2-associated transcription factor 1 (BCLAF1).	[11]
Selenium	DM25CGV	Approved	Selenium decreases the expression of Bcl-2-associated transcription factor 1 (BCLAF1).	[19]
Demecolcine	DMCZQGK	Approved	Demecolcine decreases the expression of Bcl-2-associated transcription factor 1 (BCLAF1).	[20]
Ethanol	DMDRQZU	Approved	Ethanol decreases the expression of Bcl-2-associated transcription factor 1 (BCLAF1).	[21]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of Bcl-2-associated transcription factor 1 (BCLAF1).	[22]
Capsaicin	DMGMF6V	Approved	Capsaicin increases the expression of Bcl-2-associated transcription factor 1 (BCLAF1).	[23]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene decreases the expression of Bcl-2-associated transcription factor 1 (BCLAF1).	[12]
Rigosertib	DMOSTXF	Phase 3	Rigosertib increases the expression of Bcl-2-associated transcription factor 1 (BCLAF1).	[24]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of Bcl-2-associated transcription factor 1 (BCLAF1).	[19]
Belinostat	DM6OC53	Phase 2	Belinostat decreases the expression of Bcl-2-associated transcription factor 1 (BCLAF1).	[25]
DNCB	DMDTVYC	Phase 2	DNCB decreases the expression of Bcl-2-associated transcription factor 1 (BCLAF1).	[26]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Bcl-2-associated transcription factor 1 (BCLAF1).	[27]
PF-3758309	DM36PKZ	Phase 1	PF-3758309 decreases the expression of Bcl-2-associated transcription factor 1 (BCLAF1).	[29]
Eugenol	DM7US1H	Patented	Eugenol decreases the expression of Bcl-2-associated transcription factor 1 (BCLAF1).	[26]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Bcl-2-associated transcription factor 1 (BCLAF1).	[30]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Bcl-2-associated transcription factor 1 (BCLAF1).	[31]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Bcl-2-associated transcription factor 1 (BCLAF1).	[20]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Bcl-2-associated transcription factor 1 (BCLAF1).	[32]
Paraquat	DMR8O3X	Investigative	Paraquat decreases the expression of Bcl-2-associated transcription factor 1 (BCLAF1).	[33]
geraniol	DMS3CBD	Investigative	geraniol decreases the expression of Bcl-2-associated transcription factor 1 (BCLAF1).	[35]

5 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Quercetin	DM3NC4M	Approved	Quercetin increases the phosphorylation of Bcl-2-associated transcription factor 1 (BCLAF1).	[17]
TAK-243	DM4GKV2	Phase 1	TAK-243 decreases the sumoylation of Bcl-2-associated transcription factor 1 (BCLAF1).	[28]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Bcl-2-associated transcription factor 1 (BCLAF1).	[17]
Coumarin	DM0N8ZM	Investigative	Coumarin affects the phosphorylation of Bcl-2-associated transcription factor 1 (BCLAF1).	[17]
Hexadecanoic acid	DMWUXDZ	Investigative	Hexadecanoic acid decreases the phosphorylation of Bcl-2-associated transcription factor 1 (BCLAF1).	[34]

References

• [1] miR-194-5p/BCLAF1 deregulation in AML tumorigenesis.Leukemia. 2018 Feb;32(2):573. doi: 10.1038/leu.2017.310. Epub 2017 Dec 22.
• [2] Effect of BCLAF1 on HDAC inhibitor LMK-235-mediated apoptosis of diffuse large B cell lymphoma cells and its mechanism.Cancer Biol Ther. 2018;19(9):825-834. doi: 10.1080/15384047.2018.1472188. Epub 2018 Jul 3.
• [3] Upregulated SMYD3 promotes bladder cancer progression by targeting BCLAF1 and activating autophagy.Tumour Biol. 2016 Jun;37(6):7371-81. doi: 10.1007/s13277-015-4410-2. Epub 2015 Dec 16.
• [4] BclAF1 restriction factor is neutralized by proteasomal degradation and microRNA repression during human cytomegalovirus infection.Proc Natl Acad Sci U S A. 2012 Jun 12;109(24):9575-80. doi: 10.1073/pnas.1207496109. Epub 2012 May 29.
• [5] Bclaf1 critically regulates the type I interferon response and is degraded by alphaherpesvirus US3.PLoS Pathog. 2019 Jan 25;15(1):e1007559. doi: 10.1371/journal.ppat.1007559. eCollection 2019 Jan.
• [6] Interactome based biomarker discovery for irritable bowel syndrome-A systems biology approach.Comput Biol Chem. 2018 Oct;76:218-224. doi: 10.1016/j.compbiolchem.2018.07.007. Epub 2018 Jul 10.
• [7] Bclaf1 promotes angiogenesis by regulating HIF-1 transcription in hepatocellular carcinoma.Oncogene. 2019 Mar;38(11):1845-1859. doi: 10.1038/s41388-018-0552-1. Epub 2018 Oct 26.
• [8] Germline variation in apoptosis pathway genes and risk of non-Hodgkin's lymphoma.Cancer Epidemiol Biomarkers Prev. 2010 Nov;19(11):2847-58. doi: 10.1158/1055-9965.EPI-10-0581. Epub 2010 Sep 20.
• [9] Comprehensive genomic analysis identifies SOX2 as a frequently amplified gene in small-cell lung cancer.Nat Genet. 2012 Oct;44(10):1111-6. doi: 10.1038/ng.2405. Epub 2012 Sep 2.
• [10] Emerin binding to Btf, a death-promoting transcriptional repressor, is disrupted by a missense mutation that causes Emery-Dreifuss muscular dystrophy.Eur J Biochem. 2004 Mar;271(5):1035-45. doi: 10.1111/j.1432-1033.2004.04007.x.
• [11] A genomic approach to predict synergistic combinations for breast cancer treatment. Pharmacogenomics J. 2013 Feb;13(1):94-104. doi: 10.1038/tpj.2011.48. Epub 2011 Nov 15.
• [12] Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
• [13] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [14] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [15] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [16] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [17] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [18] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [19] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [20] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [21] Gene expression signatures after ethanol exposure in differentiating embryoid bodies. Toxicol In Vitro. 2018 Feb;46:66-76.
• [22] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [23] Triggering of transient receptor potential vanilloid type 1 (TRPV1) by capsaicin induces Fas/CD95-mediated apoptosis of urothelial cancer cells in an ATM-dependent manner. Carcinogenesis. 2009 Aug;30(8):1320-9. doi: 10.1093/carcin/bgp138. Epub 2009 Jun 5.
• [24] ON 01910.Na is selectively cytotoxic for chronic lymphocytic leukemia cells through a dual mechanism of action involving PI3K/AKT inhibition and induction of oxidative stress. Clin Cancer Res. 2012 Apr 1;18(7):1979-91. doi: 10.1158/1078-0432.CCR-11-2113. Epub 2012 Feb 20.
• [25] Gene expression-signature of belinostat in cell lines is specific for histone deacetylase inhibitor treatment, with a corresponding signature in xenografts. Anticancer Drugs. 2009 Sep;20(8):682-92.
• [26] Microarray analyses in dendritic cells reveal potential biomarkers for chemical-induced skin sensitization. Mol Immunol. 2007 May;44(12):3222-33.
• [27] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [28] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [29] Inhibition of neuroblastoma proliferation by PF-3758309, a small-molecule inhibitor that targets p21-activated kinase 4. Oncol Rep. 2017 Nov;38(5):2705-2716. doi: 10.3892/or.2017.5989. Epub 2017 Sep 22.
• [30] Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.
• [31] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [32] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [33] Identification of genes associated with paraquat-induced toxicity in SH-SY5Y cells by PCR array focused on apoptotic pathways. J Toxicol Environ Health A. 2008;71(22):1457-67. doi: 10.1080/15287390802329364.
• [34] Functional lipidomics: Palmitic acid impairs hepatocellular carcinoma development by modulating membrane fluidity and glucose metabolism. Hepatology. 2017 Aug;66(2):432-448. doi: 10.1002/hep.29033. Epub 2017 Jun 16.
• [35] Geraniol suppresses prostate cancer growth through down-regulation of E2F8. Cancer Med. 2016 Oct;5(10):2899-2908.