Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT8BXLBS)

DOT Name Krueppel-like factor 14 (KLF14)
Synonyms Basic transcription element-binding protein 5; BTE-binding protein 5; Transcription factor BTEB5
Gene Name KLF14
Related Disease
Metabolic disorder ( )
Autoimmune hepatitis ( )
Cardiac failure ( )
Cardiovascular disease ( )
Colorectal carcinoma ( )
Congestive heart failure ( )
Coronary atherosclerosis ( )
Coronary heart disease ( )
Hyperinsulinemia ( )
Neoplasm ( )
Non-insulin dependent diabetes ( )
Obesity ( )
Advanced cancer ( )
Arteriosclerosis ( )
Atherosclerosis ( )
Castration-resistant prostate carcinoma ( )
Colon cancer ( )
Hepatocellular carcinoma ( )
Type-1/2 diabetes ( )
UniProt ID
KLF14_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00096
Sequence
MSAAVACLDYFAAECLVSMSAGAVVHRRPPDPEGAGGAAGSEVGAAPPESALPGPGPPGP
ASVPQLPQVPAPSPGAGGAAPHLLAASVWADLRGSSGEGSWENSGEAPRASSGFSDPIPC
SVQTPCSELAPASGAAAVCAPESSSDAPAVPSAPAAPGAPAASGGFSGGALGAGPAPAAD
QAPRRRSVTPAAKRHQCPFPGCTKAYYKSSHLKSHQRTHTGERPFSCDWLDCDKKFTRSD
ELARHYRTHTGEKRFSCPLCPKQFSRSDHLTKHARRHPTYHPDMIEYRGRRRTPRIDPPL
TSEVESSASGSGPGPAPSFTTCL

Molecular Interaction Atlas (MIA) of This DOT

19 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Metabolic disorder DIS71G5H Definitive Genetic Variation [1]
Autoimmune hepatitis DISOX03Q Strong Biomarker [2]
Cardiac failure DISDC067 Strong Biomarker [3]
Cardiovascular disease DIS2IQDX Strong Biomarker [4]
Colorectal carcinoma DIS5PYL0 Strong Biomarker [5]
Congestive heart failure DIS32MEA Strong Biomarker [3]
Coronary atherosclerosis DISKNDYU Strong Biomarker [4]
Coronary heart disease DIS5OIP1 Strong Biomarker [4]
Hyperinsulinemia DISIDWT6 Strong Altered Expression [6]
Neoplasm DISZKGEW Strong Altered Expression [7]
Non-insulin dependent diabetes DISK1O5Z Strong Altered Expression [8]
Obesity DIS47Y1K Strong Altered Expression [8]
Advanced cancer DISAT1Z9 Limited Biomarker [9]
Arteriosclerosis DISK5QGC Limited Biomarker [10]
Atherosclerosis DISMN9J3 Limited Biomarker [10]
Castration-resistant prostate carcinoma DISVGAE6 Limited Biomarker [7]
Colon cancer DISVC52G Limited Altered Expression [9]
Hepatocellular carcinoma DIS0J828 Limited Biomarker [11]
Type-1/2 diabetes DISIUHAP Limited Genetic Variation [12]
------------------------------------------------------------------------------------
⏷ Show the Full List of 19 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Krueppel-like factor 14 (KLF14). [13]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Krueppel-like factor 14 (KLF14). [14]
------------------------------------------------------------------------------------

References

1 Identification of an imprinted master trans regulator at the KLF14 locus related to multiple metabolic phenotypes.Nat Genet. 2011 Jun;43(6):561-4. doi: 10.1038/ng.833. Epub 2011 May 15.
2 Overexpression of KLF14 protects against immune-mediated hepatic injury in mice.Lab Invest. 2019 Jan;99(1):37-47. doi: 10.1038/s41374-018-0134-4. Epub 2018 Sep 25.
3 Perhexiline activates KLF14 and reduces atherosclerosis by modulating ApoA-I production.J Clin Invest. 2015 Oct 1;125(10):3819-30. doi: 10.1172/JCI79048. Epub 2015 Sep 14.
4 Krppel-like factor 14, a coronary artery disease associated transcription factor, inhibits endothelial inflammation via NF-B signaling pathway.Atherosclerosis. 2018 Nov;278:39-48. doi: 10.1016/j.atherosclerosis.2018.09.018. Epub 2018 Sep 15.
5 RNA sequencing analysis reveals protective role of kruppel-like factor 3 in colorectal cancer.Oncotarget. 2017 Mar 28;8(13):21984-21993. doi: 10.18632/oncotarget.15766.
6 Krppel-like factor 14 increases insulin sensitivity through activation of PI3K/Akt signal pathway.Cell Signal. 2015 Nov;27(11):2201-8. doi: 10.1016/j.cellsig.2015.07.019. Epub 2015 Jul 28.
7 KLF14 potentiates oxidative adaptation via modulating HO-1 signaling in castrate-resistant prostate cancer.Endocr Relat Cancer. 2019 Jan 1;26(1):181-195. doi: 10.1530/ERC-18-0383.
8 DNA methylation of the Klf14 gene region in whole blood cells provides prediction for the chronic inflammation in the adipose tissue.Biochem Biophys Res Commun. 2018 Mar 11;497(3):908-915. doi: 10.1016/j.bbrc.2017.12.104. Epub 2018 Feb 6.
9 Loss of KLF14 triggers centrosome amplification and tumorigenesis.Nat Commun. 2015 Oct 6;6:8450. doi: 10.1038/ncomms9450.
10 Krppel-like factor 14 inhibits atherosclerosis via mir-27a-mediated down-regulation of lipoprotein lipase expression in vivo.Atherosclerosis. 2019 Oct;289:143-161. doi: 10.1016/j.atherosclerosis.2019.08.012. Epub 2019 Aug 26.
11 LncRNA DGCR5 represses the development of hepatocellular carcinoma by targeting the miR-346/KLF14 axis.J Cell Physiol. 2018 Jan;234(1):572-580. doi: 10.1002/jcp.26779. Epub 2018 Sep 14.
12 Assessment of established HDL-C loci for association with HDL-C levels and type 2 diabetes in Pima Indians.Diabetologia. 2016 Mar;59(3):481-91. doi: 10.1007/s00125-015-3835-x. Epub 2015 Dec 15.
13 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
14 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.