Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT8ZPBDL)

• DOT Name: Transferrin receptor protein 1 (TFRC)
• Synonyms: TR; TfR; TfR1; Trfr; T9; p90; CD antigen CD71
• Gene Name: TFRC
• Related Disease: TFRC-related combined immunodeficiency
• UniProt ID: TFR1_HUMAN
• PDB ID: 1CX8; 1DE4; 1SUV; 2NSU; 3KAS; 3S9L; 3S9M; 3S9N; 6D03; 6D04; 6D05; 6GSR; 6H5I; 6OKD; 6W3H; 6WRV; 6WRW; 6WRX; 6Y76; 7ZQS; 8P0Z
• Pfam ID: PF02225 ; PF04389 ; PF04253
• Sequence:
  MMDQARSAFSNLFGGEPLSYTRFSLARQVDGDNSHVEMKLAVDEEENADNNTKANVTKPK
  RCSGSICYGTIAVIVFFLIGFMIGYLGYCKGVEPKTECERLAGTESPVREEPGEDFPAAR
  RLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSK
  VWRDQHFVKIQVKDSAQNSVIIVDKNGRLVYLVENPGGYVAYSKAATVTGKLVHANFGTK
  KDFEDLYTPVNGSIVIVRAGKITFAEKVANAESLNAIGVLIYMDQTKFPIVNAELSFFGH
  AHLGTGDPYTPGFPSFNHTQFPPSRSSGLPNIPVQTISRAAAEKLFGNMEGDCPSDWKTD
  STCRMVTSESKNVKLTVSNVLKEIKILNIFGVIKGFVEPDHYVVVGAQRDAWGPGAAKSG
  VGTALLLKLAQMFSDMVLKDGFQPSRSIIFASWSAGDFGSVGATEWLEGYLSSLHLKAFT
  YINLDKAVLGTSNFKVSASPLLYTLIEKTMQNVKHPVTGQFLYQDSNWASKVEKLTLDNA
  AFPFLAYSGIPAVSFCFCEDTDYPYLGTTMDTYKELIERIPELNKVARAAAEVAGQFVIK
  LTHDVELNLDYERYNSQLLSFVRDLNQYRADIKEMGLSLQWLYSARGDFFRATSRLTTDF
  GNAEKTDRFVMKKLNDRVMRVEYHFLSPYVSPKESPFRHVFWGSGSHTLPALLENLKLRK
  QNNGAFNETLFRNQLALATWTIQGAANALSGDVWDIDNEF
• Function: Cellular uptake of iron occurs via receptor-mediated endocytosis of ligand-occupied transferrin receptor into specialized endosomes. Endosomal acidification leads to iron release. The apotransferrin-receptor complex is then recycled to the cell surface with a return to neutral pH and the concomitant loss of affinity of apotransferrin for its receptor. Transferrin receptor is necessary for development of erythrocytes and the nervous system. A second ligand, the heditary hemochromatosis protein HFE, competes for binding with transferrin for an overlapping C-terminal binding site. Positively regulates T and B cell proliferation through iron uptake. Acts as a lipid sensor that regulates mitochondrial fusion by regulating activation of the JNK pathway. When dietary levels of stearate (C18:0) are low, promotes activation of the JNK pathway, resulting in HUWE1-mediated ubiquitination and subsequent degradation of the mitofusin MFN2 and inhibition of mitochondrial fusion. When dietary levels of stearate (C18:0) are high, TFRC stearoylation inhibits activation of the JNK pathway and thus degradation of the mitofusin MFN2 ; (Microbial infection) Acts as a receptor for new-world arenaviruses: Guanarito, Junin and Machupo virus.
• KEGG Pathway:
  HIF-1 sig.ling pathway (hsa04066)
  Endocytosis (hsa04144)
  Phagosome (hsa04145)
  Ferroptosis (hsa04216)
  TGF-beta sig.ling pathway (hsa04350)
  Hematopoietic cell lineage (hsa04640)
• Reactome Pathway:
  Cargo recognition for clathrin-mediated endocytosis (R-HSA-8856825)
  Clathrin-mediated endocytosis (R-HSA-8856828)
  RHOA GTPase cycle (R-HSA-8980692)
  RHOB GTPase cycle (R-HSA-9013026)
  RHOC GTPase cycle (R-HSA-9013106)
  CDC42 GTPase cycle (R-HSA-9013148)
  RAC1 GTPase cycle (R-HSA-9013149)
  RAC2 GTPase cycle (R-HSA-9013404)
  RHOQ GTPase cycle (R-HSA-9013406)
  RHOH GTPase cycle (R-HSA-9013407)
  RHOG GTPase cycle (R-HSA-9013408)
  RHOJ GTPase cycle (R-HSA-9013409)
  RAC3 GTPase cycle (R-HSA-9013423)
  Transferrin endocytosis and recycling (R-HSA-917977)
  RND2 GTPase cycle (R-HSA-9696270)
  RND1 GTPase cycle (R-HSA-9696273)
  Golgi Associated Vesicle Biogenesis (R-HSA-432722)

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
TFRC-related combined immunodeficiency	DIS55GAU	Moderate	Autosomal recessive	[1]

63 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Transferrin receptor protein 1 (TFRC).	[2]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Transferrin receptor protein 1 (TFRC).	[3]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Transferrin receptor protein 1 (TFRC).	[4]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Transferrin receptor protein 1 (TFRC).	[5]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Transferrin receptor protein 1 (TFRC).	[6]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Transferrin receptor protein 1 (TFRC).	[7]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Transferrin receptor protein 1 (TFRC).	[8]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Transferrin receptor protein 1 (TFRC).	[9]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Transferrin receptor protein 1 (TFRC).	[10]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Transferrin receptor protein 1 (TFRC).	[11]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Transferrin receptor protein 1 (TFRC).	[12]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Transferrin receptor protein 1 (TFRC).	[13]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Transferrin receptor protein 1 (TFRC).	[14]
Marinol	DM70IK5	Approved	Marinol increases the expression of Transferrin receptor protein 1 (TFRC).	[15]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Transferrin receptor protein 1 (TFRC).	[16]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Transferrin receptor protein 1 (TFRC).	[17]
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the expression of Transferrin receptor protein 1 (TFRC).	[18]
Isotretinoin	DM4QTBN	Approved	Isotretinoin decreases the expression of Transferrin receptor protein 1 (TFRC).	[19]
Hydroquinone	DM6AVR4	Approved	Hydroquinone decreases the expression of Transferrin receptor protein 1 (TFRC).	[20]
Ethanol	DMDRQZU	Approved	Ethanol increases the expression of Transferrin receptor protein 1 (TFRC).	[21]
Etoposide	DMNH3PG	Approved	Etoposide decreases the expression of Transferrin receptor protein 1 (TFRC).	[22]
Irinotecan	DMP6SC2	Approved	Irinotecan increases the expression of Transferrin receptor protein 1 (TFRC).	[23]
Nicotine	DMWX5CO	Approved	Nicotine increases the expression of Transferrin receptor protein 1 (TFRC).	[24]
Malathion	DMXZ84M	Approved	Malathion increases the expression of Transferrin receptor protein 1 (TFRC).	[25]
Indomethacin	DMSC4A7	Approved	Indomethacin decreases the expression of Transferrin receptor protein 1 (TFRC).	[26]
Cocaine	DMSOX7I	Approved	Cocaine increases the expression of Transferrin receptor protein 1 (TFRC).	[27]
Simvastatin	DM30SGU	Approved	Simvastatin affects the expression of Transferrin receptor protein 1 (TFRC).	[28]
Acetic Acid, Glacial	DM4SJ5Y	Approved	Acetic Acid, Glacial increases the expression of Transferrin receptor protein 1 (TFRC).	[29]
Motexafin gadolinium	DMEJKRF	Approved	Motexafin gadolinium increases the expression of Transferrin receptor protein 1 (TFRC).	[29]
Rofecoxib	DM3P5DA	Approved	Rofecoxib affects the expression of Transferrin receptor protein 1 (TFRC).	[30]
Dinoprostone	DMTYOPD	Approved	Dinoprostone decreases the expression of Transferrin receptor protein 1 (TFRC).	[31]
Isoproterenol	DMK7MEY	Approved	Isoproterenol decreases the expression of Transferrin receptor protein 1 (TFRC).	[31]
Ardeparin	DMYRX8B	Approved	Ardeparin decreases the expression of Transferrin receptor protein 1 (TFRC).	[32]
Vitamin A	DMJ2AH4	Approved	Vitamin A decreases the expression of Transferrin receptor protein 1 (TFRC).	[33]
Heroin diacetylmorphine	DMDBWHY	Approved	Heroin diacetylmorphine increases the expression of Transferrin receptor protein 1 (TFRC).	[34]
Gallium nitrate	DMF9O6B	Approved	Gallium nitrate decreases the expression of Transferrin receptor protein 1 (TFRC).	[35]
Trabectedin	DMG3Y89	Approved	Trabectedin increases the expression of Transferrin receptor protein 1 (TFRC).	[36]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Transferrin receptor protein 1 (TFRC).	[37]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Transferrin receptor protein 1 (TFRC).	[38]
Curcumin	DMQPH29	Phase 3	Curcumin increases the expression of Transferrin receptor protein 1 (TFRC).	[39]
Atorvastatin	DMF28YC	Phase 3 Trial	Atorvastatin affects the expression of Transferrin receptor protein 1 (TFRC).	[28]
OSI-906	DMHKZLF	Phase 3	OSI-906 decreases the expression of Transferrin receptor protein 1 (TFRC).	[40]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Transferrin receptor protein 1 (TFRC).	[41]
Phenol	DM1QSM3	Phase 2/3	Phenol decreases the expression of Transferrin receptor protein 1 (TFRC).	[20]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate decreases the expression of Transferrin receptor protein 1 (TFRC).	[42]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Transferrin receptor protein 1 (TFRC).	[43]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Transferrin receptor protein 1 (TFRC).	[44]
Piperazinyl methyl quinazolinone derivative 2	DM913KS	Patented	Piperazinyl methyl quinazolinone derivative 2 increases the expression of Transferrin receptor protein 1 (TFRC).	[46]
KENPAULLONE	DMAGVXW	Patented	KENPAULLONE increases the expression of Transferrin receptor protein 1 (TFRC).	[32]
Torcetrapib	DMDHYM7	Discontinued in Phase 2	Torcetrapib increases the expression of Transferrin receptor protein 1 (TFRC).	[47]
SB-431542	DM0YOXQ	Preclinical	SB-431542 increases the expression of Transferrin receptor protein 1 (TFRC).	[48]
GGTI-298	DM1CG0J	Terminated	GGTI-298 decreases the expression of Transferrin receptor protein 1 (TFRC).	[49]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of Transferrin receptor protein 1 (TFRC).	[50]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Transferrin receptor protein 1 (TFRC).	[51]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Transferrin receptor protein 1 (TFRC).	[52]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Transferrin receptor protein 1 (TFRC).	[53]
Paraquat	DMR8O3X	Investigative	Paraquat affects the expression of Transferrin receptor protein 1 (TFRC).	[54]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of Transferrin receptor protein 1 (TFRC).	[55]
PP-242	DM2348V	Investigative	PP-242 decreases the expression of Transferrin receptor protein 1 (TFRC).	[56]
Cordycepin	DM72Y01	Investigative	Cordycepin affects the expression of Transferrin receptor protein 1 (TFRC).	[57]
Protoporphyrin IX	DMWYE7A	Investigative	Protoporphyrin IX decreases the expression of Transferrin receptor protein 1 (TFRC).	[58]
Dorsomorphin	DMKYXJW	Investigative	Dorsomorphin decreases the expression of Transferrin receptor protein 1 (TFRC).	[32]
GW7604	DMCA4RM	Investigative	GW7604 increases the expression of Transferrin receptor protein 1 (TFRC).	[18]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Transferrin receptor protein 1 (TFRC).	[45]
Coumarin	DM0N8ZM	Investigative	Coumarin decreases the phosphorylation of Transferrin receptor protein 1 (TFRC).	[45]

References

• [1] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [2] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [3] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [4] Retinoic acid-induced downmodulation of telomerase activity in human cancer cells. Exp Mol Pathol. 2005 Oct;79(2):108-17.
• [5] Increased mitochondrial ROS formation by acetaminophen in human hepatic cells is associated with gene expression changes suggesting disruption of the mitochondrial electron transport chain. Toxicol Lett. 2015 Apr 16;234(2):139-50.
• [6] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [7] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [8] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [9] Transcriptional responses to estrogen and progesterone in mammary gland identify networks regulating p53 activity. Endocrinology. 2008 Oct;149(10):4809-20. doi: 10.1210/en.2008-0035. Epub 2008 Jun 12.
• [10] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [11] Quantitative proteomic analysis of HepG2 cells treated with quercetin suggests IQGAP1 involved in quercetin-induced regulation of cell proliferation and migration. OMICS. 2009 Apr;13(2):93-103. doi: 10.1089/omi.2008.0075.
• [12] Arsenic trioxide induces apoptosis of human monocytes during macrophagic differentiation through nuclear factor-kappaB-related survival pathway down-regulation. J Pharmacol Exp Ther. 2006 Jan;316(1):304-14. doi: 10.1124/jpet.105.092874. Epub 2005 Sep 20.
• [13] Relationships and distinctions in iron-regulatory networks responding to interrelated signals. Blood. 2003 May 1;101(9):3690-8. doi: 10.1182/blood-2002-07-2140. Epub 2002 Sep 26.
• [14] Influence of exogenous oestrogen or (anti-) androgen administration on soluble transferrin receptor in human plasma. J Endocrinol. 2005 Jul;186(1):61-7. doi: 10.1677/joe.1.06112.
• [15] JunD is involved in the antiproliferative effect of Delta9-tetrahydrocannabinol on human breast cancer cells. Oncogene. 2008 Aug 28;27(37):5033-44.
• [16] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [17] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [18] Gene expression profiles with activation of the estrogen receptor alpha-selective estrogen receptor modulator complex in breast cancer cells expressing wild-type estrogen receptor. Cancer Res. 2002 Aug 1;62(15):4419-26.
• [19] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [20] Phenolic metabolites of benzene inhibited the erythroid differentiation of K562 cells. Toxicol Lett. 2011 Jun 24;203(3):190-9. doi: 10.1016/j.toxlet.2011.03.012. Epub 2011 Mar 23.
• [21] Comparison of replicative senescence and stress-induced premature senescence combining differential display and low-density DNA arrays. FEBS Lett. 2005 Jul 4;579(17):3651-9. doi: 10.1016/j.febslet.2005.05.056.
• [22] Lysosome Fe(2+) release is responsible for etoposide- and cisplatin-induced stemness of small cell lung cancer cells. Environ Toxicol. 2021 Aug;36(8):1654-1663. doi: 10.1002/tox.23161. Epub 2021 May 10.
• [23] Clinical determinants of response to irinotecan-based therapy derived from cell line models. Clin Cancer Res. 2008 Oct 15;14(20):6647-55.
• [24] Nicotinic modulation of gene expression in SH-SY5Y neuroblastoma cells. Brain Res. 2006 Oct 20;1116(1):39-49.
• [25] Malathion induced cancer-linked gene expression in human lymphocytes. Environ Res. 2020 Mar;182:109131. doi: 10.1016/j.envres.2020.109131. Epub 2020 Jan 10.
• [26] Mechanisms of indomethacin-induced alterations in the choline phospholipid metabolism of breast cancer cells. Neoplasia. 2006 Sep;8(9):758-71.
• [27] Gene expression profile of the nucleus accumbens of human cocaine abusers: evidence for dysregulation of myelin. J Neurochem. 2004 Mar;88(5):1211-9. doi: 10.1046/j.1471-4159.2003.02247.x.
• [28] Differential effects of statins on relevant functions of human monocyte-derived dendritic cells. J Leukoc Biol. 2006 Mar;79(3):529-38. doi: 10.1189/jlb.0205064. Epub 2005 Dec 30.
• [29] Motexafin gadolinium and zinc induce oxidative stress responses and apoptosis in B-cell lymphoma lines. Cancer Res. 2005 Dec 15;65(24):11676-88.
• [30] Rofecoxib modulates multiple gene expression pathways in a clinical model of acute inflammatory pain. Pain. 2007 Mar;128(1-2):136-47.
• [31] Prostaglandin E2 acts at two distinct pathways of T lymphocyte activation: inhibition of interleukin 2 production and down-regulation of transferrin receptor expression. J Immunol. 1985 Aug;135(2):1172-9.
• [32] A HAMP promoter bioassay system for identifying chemical compounds that modulate hepcidin expression. Exp Hematol. 2015 May;43(5):404-413.e5. doi: 10.1016/j.exphem.2015.01.005. Epub 2015 Jan 26.
• [33] Vitamin A supplementation in children with poor vitamin A and iron status increases erythropoietin and hemoglobin concentrations without changing total body iron. Am J Clin Nutr. 2006 Sep;84(3):580-6. doi: 10.1093/ajcn/84.3.580.
• [34] Distinctive profiles of gene expression in the human nucleus accumbens associated with cocaine and heroin abuse. Neuropsychopharmacology. 2006 Oct;31(10):2304-12. doi: 10.1038/sj.npp.1301089. Epub 2006 May 3.
• [35] Role of oxidative stress in the induction of metallothionein-2A and heme oxygenase-1 gene expression by the antineoplastic agent gallium nitrate in human lymphoma cells. Free Radic Biol Med. 2008 Sep 15;45(6):763-72.
• [36] Trabectedin induces ferroptosis via regulation of HIF-1/IRP1/TFR1 and Keap1/Nrf2/GPX4 axis in non-small cell lung cancer cells. Chem Biol Interact. 2023 Jan 5;369:110262. doi: 10.1016/j.cbi.2022.110262. Epub 2022 Nov 14.
• [37] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [38] Resveratrol induces apoptosis and alters gene expression in human fibrosarcoma cells. Anticancer Res. 2015 Feb;35(2):767-74.
• [39] Gene-expression profiling during curcumin-induced apoptosis reveals downregulation of CXCR4. Exp Hematol. 2007 Jan;35(1):84-95.
• [40] Screening of Organophosphate Flame Retardants with Placentation-Disrupting Effects in Human Trophoblast Organoid Model and Characterization of Adverse Pregnancy Outcomes in Mice. Environ Health Perspect. 2022 May;130(5):57002. doi: 10.1289/EHP10273. Epub 2022 May 3.
• [41] Quantitative proteomics and transcriptomics addressing the estrogen receptor subtype-mediated effects in T47D breast cancer cells exposed to the phytoestrogen genistein. Mol Cell Proteomics. 2011 Jan;10(1):M110.002170.
• [42] Di-n-butyl phthalate modifies PMA-induced macrophage differentiation of THP-1 monocytes via PPAR. Toxicol In Vitro. 2019 Feb;54:168-177. doi: 10.1016/j.tiv.2018.09.004. Epub 2018 Sep 12.
• [43] Gene expression profiling in Caco-2 human colon cells exposed to TCDD, benzo[a]pyrene, and natural Ah receptor agonists from cruciferous vegetables and citrus fruits. Toxicol In Vitro. 2008 Mar;22(2):396-410.
• [44] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [45] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [46] Protective effect of sestrin2 against iron overload and ferroptosis-induced liver injury. Toxicol Appl Pharmacol. 2019 Sep 15;379:114665. doi: 10.1016/j.taap.2019.114665. Epub 2019 Jul 16.
• [47] Clarifying off-target effects for torcetrapib using network pharmacology and reverse docking approach. BMC Syst Biol. 2012 Dec 10;6:152.
• [48] Activin/nodal signaling switches the terminal fate of human embryonic stem cell-derived trophoblasts. J Biol Chem. 2015 Apr 3;290(14):8834-48.
• [49] Statin-induced inhibition of breast cancer proliferation and invasion involves attenuation of iron transport: intermediacy of nitric oxide and antioxidant defence mechanisms. FEBS J. 2014 Aug;281(16):3719-38.
• [50] Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
• [51] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [52] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [53] Silibinin inhibits ethanol- or acetaldehyde-induced ferroptosis in liver cell lines. Toxicol In Vitro. 2022 Aug;82:105388. doi: 10.1016/j.tiv.2022.105388. Epub 2022 May 18.
• [54] Paraquat-induced ferroptosis suppression via NRF2 expression regulation. Toxicol In Vitro. 2023 Oct;92:105655. doi: 10.1016/j.tiv.2023.105655. Epub 2023 Jul 26.
• [55] Nickel decreases cellular iron level and converts cytosolic aconitase to iron-regulatory protein 1 in A549 cells. Toxicol Appl Pharmacol. 2005 Aug 15;206(3):275-87. doi: 10.1016/j.taap.2004.11.011. Epub 2004 Dec 25.
• [56] Marine biogenics in sea spray aerosols interact with the mTOR signaling pathway. Sci Rep. 2019 Jan 24;9(1):675.
• [57] Effect of cordycepin on interleukin-10 production of human peripheral blood mononuclear cells. Eur J Pharmacol. 2002 Oct 25;453(2-3):309-17. doi: 10.1016/s0014-2999(02)02359-2.
• [58] Iron regulation and the cell cycle: identification of an iron-responsive element in the 3'-untranslated region of human cell division cycle 14A mRNA by a refined microarray-based screening strategy. J Biol Chem. 2006 Aug 11;281(32):22865-74. doi: 10.1074/jbc.M603876200. Epub 2006 Jun 7.