Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT9DERT1)

• DOT Name: Gamma-interferon-inducible lysosomal thiol reductase (IFI30)
• Synonyms: EC 1.8.-.-; Gamma-interferon-inducible protein IP-30; Legumaturain
• Gene Name: IFI30
• Related Disease:
  Acute myelogenous leukaemia
  Allergic contact dermatitis
  Glioma
  Multiple sclerosis
  Neoplasm
  Neuromyelitis optica
  Obesity
  Factor IX deficiency
  Non-insulin dependent diabetes
  Autoimmune disease
  Breast cancer
  Breast carcinoma
  Cardiovascular disease
  Ebola virus infection
  Hyperglycemia
  Lassa fever
  Melanoma
  Metastatic melanoma
  Mitochondrial myopathy
• UniProt ID: GILT_HUMAN
• EC Number: 1.8.-.-
• Pfam ID: PF03227
• Sequence:
  MTLSPLLLFLPPLLLLLDVPTAAVQASPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAP
  LVNVTLYYEALCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHG
  EEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAM
  GDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGKKPDVCPSS
  TSSLRSVCFK
• Function: Lysosomal thiol reductase that can reduce protein disulfide bonds. May facilitate the complete unfolding of proteins destined for lysosomal degradation. Plays an important role in antigen processing. Facilitates the generation of MHC class II-restricted epitodes from disulfide bond-containing antigen by the endocytic reduction of disulfide bonds. Facilitates also MHC class I-restricted recognition of exogenous antigens containing disulfide bonds by CD8+ T-cells or crosspresentation.
• KEGG Pathway: Antigen processing and presentation (hsa04612)
• Reactome Pathway:
  Interferon gamma signaling (R-HSA-877300)
  MHC class II antigen presentation (R-HSA-2132295)

Molecular Interaction Atlas (MIA) of This DOT

19 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acute myelogenous leukaemia	DISCSPTN	Strong	Biomarker	[1]
Allergic contact dermatitis	DISFFVF9	Strong	Biomarker	[2]
Glioma	DIS5RPEH	Strong	Altered Expression	[3]
Multiple sclerosis	DISB2WZI	Strong	Genetic Variation	[4]
Neoplasm	DISZKGEW	Strong	Biomarker	[3]
Neuromyelitis optica	DISBFGKL	Strong	Biomarker	[5]
Obesity	DIS47Y1K	Strong	Genetic Variation	[6]
Factor IX deficiency	DISHN9SC	moderate	Biomarker	[7]
Non-insulin dependent diabetes	DISK1O5Z	Disputed	Genetic Variation	[8]
Autoimmune disease	DISORMTM	Limited	Biomarker	[9]
Breast cancer	DIS7DPX1	Limited	Biomarker	[10]
Breast carcinoma	DIS2UE88	Limited	Altered Expression	[10]
Cardiovascular disease	DIS2IQDX	Limited	Genetic Variation	[11]
Ebola virus infection	DISJAVM1	Limited	Biomarker	[12]
Hyperglycemia	DIS0BZB5	Limited	Genetic Variation	[11]
Lassa fever	DISKFYGZ	Limited	Biomarker	[12]
Melanoma	DIS1RRCY	Limited	Altered Expression	[13]
Metastatic melanoma	DISSL43L	Limited	Altered Expression	[14]
Mitochondrial myopathy	DIS9SA7V	Limited	Biomarker	[15]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Paclitaxel	DMLB81S	Approved	Gamma-interferon-inducible lysosomal thiol reductase (IFI30) decreases the response to substance of Paclitaxel.	[36]

20 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Gamma-interferon-inducible lysosomal thiol reductase (IFI30).	[16]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Gamma-interferon-inducible lysosomal thiol reductase (IFI30).	[17]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Gamma-interferon-inducible lysosomal thiol reductase (IFI30).	[18]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Gamma-interferon-inducible lysosomal thiol reductase (IFI30).	[19]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Gamma-interferon-inducible lysosomal thiol reductase (IFI30).	[20]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Gamma-interferon-inducible lysosomal thiol reductase (IFI30).	[21]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Gamma-interferon-inducible lysosomal thiol reductase (IFI30).	[22]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Gamma-interferon-inducible lysosomal thiol reductase (IFI30).	[23]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Gamma-interferon-inducible lysosomal thiol reductase (IFI30).	[24]
Aspirin	DM672AH	Approved	Aspirin decreases the expression of Gamma-interferon-inducible lysosomal thiol reductase (IFI30).	[26]
Lucanthone	DMZLBUO	Approved	Lucanthone increases the expression of Gamma-interferon-inducible lysosomal thiol reductase (IFI30).	[27]
Testosterone Undecanoate	DMZO10Y	Approved	Testosterone Undecanoate increases the expression of Gamma-interferon-inducible lysosomal thiol reductase (IFI30).	[28]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Gamma-interferon-inducible lysosomal thiol reductase (IFI30).	[24]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Gamma-interferon-inducible lysosomal thiol reductase (IFI30).	[29]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Gamma-interferon-inducible lysosomal thiol reductase (IFI30).	[30]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Gamma-interferon-inducible lysosomal thiol reductase (IFI30).	[31]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Gamma-interferon-inducible lysosomal thiol reductase (IFI30).	[32]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Gamma-interferon-inducible lysosomal thiol reductase (IFI30).	[33]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Gamma-interferon-inducible lysosomal thiol reductase (IFI30).	[34]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Gamma-interferon-inducible lysosomal thiol reductase (IFI30).	[35]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Fulvestrant	DM0YZC6	Approved	Fulvestrant decreases the methylation of Gamma-interferon-inducible lysosomal thiol reductase (IFI30).	[25]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Gamma-interferon-inducible lysosomal thiol reductase (IFI30).	[25]

References

• [1] Discovery of epigenetically silenced genes in acute myeloid leukemias.Leukemia. 2007 May;21(5):1026-34. doi: 10.1038/sj.leu.2404611. Epub 2007 Mar 1.
• [2] Gene expression time course in the human skin during elicitation of allergic contact dermatitis.J Invest Dermatol. 2007 Nov;127(11):2585-95. doi: 10.1038/sj.jid.5700902. Epub 2007 Jun 28.
• [3] Lentivirus mediated -interferon-inducible lysosomal thiol reductase (GILT) knockdown suppresses human glioma U373MG cell proliferation.Biochem Biophys Res Commun. 2019 Jan 29;509(1):182-187. doi: 10.1016/j.bbrc.2018.12.099. Epub 2018 Dec 23.
• [4] Analysis of immune-related loci identifies 48 new susceptibility variants for multiple sclerosis.Nat Genet. 2013 Nov;45(11):1353-60. doi: 10.1038/ng.2770. Epub 2013 Sep 29.
• [5] Neuromyelitis optica/Devic's disease: gene expression profiling of brain lesions.Neuropathology. 2008 Dec;28(6):561-76. doi: 10.1111/j.1440-1789.2008.00915.x. Epub 2008 Apr 7.
• [6] Genetic contribution to C-reactive protein levels in severe obesity.Mol Genet Metab. 2012 Mar;105(3):494-501. doi: 10.1016/j.ymgme.2011.11.198. Epub 2011 Dec 2.
• [7] Perioperative haemostatic management of haemophilic mice using normal mouse plasma.Haemophilia. 2013 Nov;19(6):e335-43. doi: 10.1111/hae.12211. Epub 2013 Jul 16.
• [8] Analysis of Gene Candidate SNP and Ancestral Origin Associated to Obesity and Postoperative Weight Loss in a Cohort of Obese Patients Undergoing RYGB.Obes Surg. 2017 Jun;27(6):1481-1492. doi: 10.1007/s11695-016-2501-9.
• [9] The phagosome and redox control of antigen processing.Free Radic Biol Med. 2018 Sep;125:53-61. doi: 10.1016/j.freeradbiomed.2018.03.040. Epub 2018 Mar 22.
• [10] Absence of gamma-interferon-inducible lysosomal thiol reductase (GILT) is associated with poor disease-free survival in breast cancer patients.PLoS One. 2014 Oct 21;9(10):e109449. doi: 10.1371/journal.pone.0109449. eCollection 2014.
• [11] A polymorphism of the interferon-gamma-inducible protein 30 gene is associated with hyperglycemia in severely obese individuals.Hum Genet. 2012 Jan;131(1):57-66. doi: 10.1007/s00439-011-1043-4. Epub 2011 Jun 24.
• [12] GILT restricts the cellular entry mediated by the envelope glycoproteins of SARS-CoV, Ebola virus and Lassa fever virus.Emerg Microbes Infect. 2019;8(1):1511-1523. doi: 10.1080/22221751.2019.1677446.
• [13] High GILT Expression and an Active and Intact MHC Class II Antigen Presentation Pathway Are Associated with Improved Survival in Melanoma.J Immunol. 2019 Nov 15;203(10):2577-2587. doi: 10.4049/jimmunol.1900476. Epub 2019 Oct 7.
• [14] Autophagy-dependent crosstalk between GILT and PAX-3 influences radiation sensitivity of human melanoma cells.J Cell Biochem. 2018 Feb;119(2):2212-2221. doi: 10.1002/jcb.26383. Epub 2017 Oct 18.
• [15] Cloning of the human mitochondrial 51 kDa subunit (NDUFV1) reveals a 100% antisense homology of its 3'UTR with the 5'UTR of the gamma-interferon inducible protein (IP-30) precursor: is this a link between mitochondrial myopathy and inflammation?.Biochem Biophys Res Commun. 1998 Apr 17;245(2):599-606. doi: 10.1006/bbrc.1998.8486.
• [16] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [17] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [18] Systems analysis of transcriptome and proteome in retinoic acid/arsenic trioxide-induced cell differentiation/apoptosis of promyelocytic leukemia. Proc Natl Acad Sci U S A. 2005 May 24;102(21):7653-8.
• [19] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [20] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [21] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [22] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [23] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [24] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [25] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [26] Expression profile analysis of human peripheral blood mononuclear cells in response to aspirin. Arch Immunol Ther Exp (Warsz). 2005 Mar-Apr;53(2):151-8.
• [27] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [28] Levonorgestrel enhances spermatogenesis suppression by testosterone with greater alteration in testicular gene expression in men. Biol Reprod. 2009 Mar;80(3):484-92.
• [29] A novel long noncoding RNA AK001796 acts as an oncogene and is involved in cell growth inhibition by resveratrol in lung cancer. Toxicol Appl Pharmacol. 2015 Jun 1;285(2):79-88.
• [30] Chlorophyllin significantly reduces benzo[a]pyrene-DNA adduct formation and alters cytochrome P450 1A1 and 1B1 expression and EROD activity in normal human mammary epithelial cells. Environ Mol Mutagen. 2009 Mar;50(2):134-44.
• [31] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [32] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [33] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [34] Sulforaphane-induced apoptosis in human leukemia HL-60 cells through extrinsic and intrinsic signal pathways and altering associated genes expression assayed by cDNA microarray. Environ Toxicol. 2017 Jan;32(1):311-328.
• [35] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
• [36] cDNA microarray analysis of isogenic paclitaxel- and doxorubicin-resistant breast tumor cell lines reveals distinct drug-specific genetic signatures of resistance. Breast Cancer Res Treat. 2006 Mar;96(1):17-39. doi: 10.1007/s10549-005-9026-6. Epub 2005 Dec 2.