Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT9LGHV0)

DOT Name C-C motif chemokine 24 (CCL24)
Synonyms CK-beta-6; Eosinophil chemotactic protein 2; Eotaxin-2; Myeloid progenitor inhibitory factor 2; MPIF-2; Small-inducible cytokine A24
Gene Name CCL24
Related Disease
Primary biliary cholangitis ( )
Allergic rhinitis ( )
Allergy ( )
Ataxia-telangiectasia ( )
Atopic dermatitis ( )
Autoimmune disease ( )
Bronchopulmonary dysplasia ( )
Colorectal carcinoma ( )
Depression ( )
Fibromyalgia ( )
Irritant contact dermatitis ( )
Major depressive disorder ( )
Nasal polyp ( )
Neoplasm ( )
Polyp ( )
Pulmonary fibrosis ( )
Rheumatoid arthritis ( )
Systemic sclerosis ( )
Ulcerative colitis ( )
Advanced cancer ( )
Conjunctival disorder ( )
Graft-versus-host disease ( )
Hepatocellular carcinoma ( )
Perennial allergic rhinitis ( )
Tuberous sclerosis ( )
Asthma ( )
Bone osteosarcoma ( )
Chronic obstructive pulmonary disease ( )
Osteosarcoma ( )
Pneumonia ( )
Pneumonitis ( )
Schistosomiasis ( )
Vernal keratoconjunctivitis ( )
UniProt ID
CCL24_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1EIG; 1EIH
Pfam ID
PF00048
Sequence
MAGLMTIVTSLLFLGVCAHHIIPTGSVVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLK
AGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC
Function
Chemotactic for resting T-lymphocytes, and eosinophils. Has lower chemotactic activity for neutrophils but none for monocytes and activated lymphocytes. Is a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line. Binds to CCR3.
Tissue Specificity Activated monocytes and activated T lymphocytes.
KEGG Pathway
Cytokine-cytokine receptor interaction (hsa04060 )
Viral protein interaction with cytokine and cytokine receptor (hsa04061 )
Chemokine sig.ling pathway (hsa04062 )

Molecular Interaction Atlas (MIA) of This DOT

33 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Primary biliary cholangitis DIS43E0O Definitive Biomarker [1]
Allergic rhinitis DIS3U9HN Strong Genetic Variation [2]
Allergy DIS48ZAP Strong Biomarker [3]
Ataxia-telangiectasia DISP3EVR Strong Altered Expression [4]
Atopic dermatitis DISTCP41 Strong Biomarker [5]
Autoimmune disease DISORMTM Strong Genetic Variation [6]
Bronchopulmonary dysplasia DISO0BY5 Strong Biomarker [7]
Colorectal carcinoma DIS5PYL0 Strong Biomarker [8]
Depression DIS3XJ69 Strong Biomarker [9]
Fibromyalgia DISZJDS2 Strong Altered Expression [9]
Irritant contact dermatitis DIS62JY3 Strong Biomarker [10]
Major depressive disorder DIS4CL3X Strong Biomarker [11]
Nasal polyp DISLP3XE Strong Altered Expression [12]
Neoplasm DISZKGEW Strong Biomarker [8]
Polyp DISRSLYF Strong Altered Expression [12]
Pulmonary fibrosis DISQKVLA Strong Biomarker [13]
Rheumatoid arthritis DISTSB4J Strong Genetic Variation [6]
Systemic sclerosis DISF44L6 Strong Altered Expression [13]
Ulcerative colitis DIS8K27O Strong Biomarker [14]
Advanced cancer DISAT1Z9 moderate Biomarker [8]
Conjunctival disorder DISPTOTB moderate Biomarker [15]
Graft-versus-host disease DIS0QADF moderate Biomarker [16]
Hepatocellular carcinoma DIS0J828 moderate Biomarker [8]
Perennial allergic rhinitis DISVJCA1 moderate Biomarker [17]
Tuberous sclerosis DISEMUGZ moderate Altered Expression [18]
Asthma DISW9QNS Limited Altered Expression [19]
Bone osteosarcoma DIST1004 Limited Altered Expression [20]
Chronic obstructive pulmonary disease DISQCIRF Limited Altered Expression [21]
Osteosarcoma DISLQ7E2 Limited Altered Expression [20]
Pneumonia DIS8EF3M Limited Biomarker [13]
Pneumonitis DIS88E0K Limited Biomarker [13]
Schistosomiasis DIS6PD44 Limited Biomarker [22]
Vernal keratoconjunctivitis DIS36LV6 Limited Biomarker [23]
------------------------------------------------------------------------------------
⏷ Show the Full List of 33 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin increases the expression of C-C motif chemokine 24 (CCL24). [24]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of C-C motif chemokine 24 (CCL24). [27]
Phencyclidine DMQBEYX Investigative Phencyclidine increases the expression of C-C motif chemokine 24 (CCL24). [28]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of C-C motif chemokine 24 (CCL24). [25]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of C-C motif chemokine 24 (CCL24). [26]
------------------------------------------------------------------------------------

References

1 Association of CCL11, CCL24 and CCL26 with primary biliary cholangitis.Int Immunopharmacol. 2019 Feb;67:372-377. doi: 10.1016/j.intimp.2018.12.026. Epub 2018 Dec 22.
2 The suggestive association of eotaxin-2 and eotaxin-3 gene polymorphisms in Korean population with allergic rhinitis.Immunogenetics. 2005 Jan;56(10):760-4. doi: 10.1007/s00251-004-0746-2. Epub 2004 Dec 4.
3 Expansion of CD4(+) CD25(+) and CD25(-) T-Bet, GATA-3, Foxp3 and RORt cells in allergic inflammation, local lung distribution and chemokine gene expression.PLoS One. 2011;6(5):e19889. doi: 10.1371/journal.pone.0019889. Epub 2011 May 19.
4 Genetic variability in CRTH2 polymorphism increases eotaxin-2 levels in patients with aspirin exacerbated respiratory disease.Allergy. 2010 Mar;65(3):338-46. doi: 10.1111/j.1398-9995.2009.02158.x. Epub 2009 Oct 1.
5 Peroxisome proliferator-activated receptor alpha regulates skin inflammation and humoral response in atopic dermatitis.J Allergy Clin Immunol. 2008 Apr;121(4):962-8.e6. doi: 10.1016/j.jaci.2007.12.1165. Epub 2008 Feb 4.
6 Eotaxin-3 gene polymorphisms are associated with rheumatoid arthritis in a Korean population.Hum Immunol. 2005 Mar;66(3):314-20. doi: 10.1016/j.humimm.2005.01.002.
7 Increased serum Th2 chemokine levels are associated with bronchopulmonary dysplasia in premature infants.Eur J Pediatr. 2019 Jan;178(1):81-87. doi: 10.1007/s00431-018-3266-z. Epub 2018 Oct 15.
8 CCL24 contributes to HCC malignancy via RhoB- VEGFA-VEGFR2 angiogenesis pathway and indicates poor prognosis.Oncotarget. 2017 Jan 17;8(3):5135-5148. doi: 10.18632/oncotarget.14095.
9 Elevated Levels of Eotaxin-2 in Serum of Fibromyalgia Patients.Pain Res Manag. 2018 May 13;2018:7257681. doi: 10.1155/2018/7257681. eCollection 2018.
10 Pre-administration of PepFect6-microRNA-146a nanocomplexes inhibits inflammatory responses in keratinocytes and in a mouse model of irritant contact dermatitis.J Control Release. 2016 Aug 10;235:195-204. doi: 10.1016/j.jconrel.2016.06.006. Epub 2016 Jun 3.
11 Putative transcriptomic biomarkers in the inflammatory cytokine pathway differentiate major depressive disorder patients from control subjects and bipolar disorder patients.PLoS One. 2014 Mar 11;9(3):e91076. doi: 10.1371/journal.pone.0091076. eCollection 2014.
12 Hemokinin-1 stimulates C-C motif chemokine ligand 24 production in macrophages to enhance eosinophilic inflammation in nasal polyps.Int Forum Allergy Rhinol. 2019 Nov;9(11):1334-1345. doi: 10.1002/alr.22430. Epub 2019 Sep 23.
13 Blockade of CCL24 with a monoclonal antibody ameliorates experimental dermal and pulmonary fibrosis.Ann Rheum Dis. 2019 Sep;78(9):1260-1268. doi: 10.1136/annrheumdis-2019-215119. Epub 2019 May 25.
14 Increased expression of chemokine receptor CCR3 and its ligands in ulcerative colitis: the role of colonic epithelial cells in in vitro studies.Clin Exp Immunol. 2010 Nov;162(2):337-47. doi: 10.1111/j.1365-2249.2010.04248.x.
15 The proteolytic effect of mast cell tryptase to eotaxin-1/CCL11eotaxin-2/CCL24 and eotaxin-3/CCL26 produced by conjunctival fibroblasts.Jpn J Ophthalmol. 2019 Mar;63(2):215-220. doi: 10.1007/s10384-019-00655-w. Epub 2019 Feb 22.
16 Mesenchymal Stromal Cell (MSC)-Derived Combination of CXCL5 and Anti-CCL24 Is Synergistic and Superior to MSC and Cyclosporine for the Treatment of Graft-versus-Host Disease.Biol Blood Marrow Transplant. 2018 Oct;24(10):1971-1980. doi: 10.1016/j.bbmt.2018.05.029. Epub 2018 Jun 5.
17 Effects of Fluticasone Furoate Nasal Spray on Parameters of Eosinophilic Inflammation in Patients With Nasal Polyposis and Perennial Allergic Rhinitis.Ann Otol Rhinol Laryngol. 2017 Aug;126(8):573-580. doi: 10.1177/0003489417713505. Epub 2017 Jun 6.
18 Inflammatory Characteristics of Monocytes from Pediatric Patients with Tuberous Sclerosis.Neuropediatrics. 2015 Oct;46(5):335-43. doi: 10.1055/s-0035-1562925. Epub 2015 Sep 10.
19 Association Between Epithelial Cytokines and Clinical Phenotypes of Elderly Asthma.Allergy Asthma Immunol Res. 2019 Jan;11(1):79-89. doi: 10.4168/aair.2019.11.1.79.
20 Melatonin attenuates osteosarcoma cell invasion by suppression of C-C motif chemokine ligand 24 through inhibition of the c-Jun N-terminal kinase pathway.J Pineal Res. 2018 Oct;65(3):e12507. doi: 10.1111/jpi.12507. Epub 2018 May 28.
21 Modulation of blood inflammatory markers by benralizumab in patients with eosinophilic airway diseases.Respir Res. 2019 Jan 18;20(1):14. doi: 10.1186/s12931-018-0968-8.
22 Plasma levels of innate immune mediators are associated with liver fibrosis in low parasite burden Schistosoma mansoni-infected individuals.Scand J Immunol. 2018 Mar;87(3). doi: 10.1111/sji.12642. Epub 2018 Feb 26.
23 Evaluation of eotaxin-1, -2, and -3 protein production and messenger RNA expression in patients with vernal keratoconjunctivitis.Jpn J Ophthalmol. 2009 Mar;53(2):92-99. doi: 10.1007/s10384-008-0628-5. Epub 2009 Mar 31.
24 Chemokine induction by all-trans retinoic acid and arsenic trioxide in acute promyelocytic leukemia: triggering the differentiation syndrome. Blood. 2009 Dec 24;114(27):5512-21. doi: 10.1182/blood-2009-02-204834. Epub 2009 Oct 14.
25 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
26 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
27 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
28 Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.