Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTCCWMGK)

• DOT Name: Tubulin-specific chaperone A (TBCA)
• Synonyms: TCP1-chaperonin cofactor A; Tubulin-folding cofactor A; CFA
• Gene Name: TBCA
• Related Disease:
  Hepatocellular carcinoma
  Liver cancer
  Tuberculosis
  Analgesia
  Ankylosing spondylitis
  Atopic dermatitis
  Cleft lip
  Dementia
  Depression
  Familial adenomatous polyposis 2
  Hypertrophic cardiomyopathy
  Isolated cleft lip
  Neoplasm
  Nervous system inflammation
  Neuralgia
  Prostatitis
  Rheumatoid arthritis
  Arthritis
  Diphtheria
  Psychotic disorder
• UniProt ID: TBCA_HUMAN
• PDB ID: 1H7C
• Pfam ID: PF02970
• Sequence:
  MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQES
  RMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEYKEARLVLDSVKLEA
• Function: Tubulin-folding protein; involved in the early step of the tubulin folding pathway.
• Reactome Pathway: Post-chaperonin tubulin folding pathway (R-HSA-389977)

Molecular Interaction Atlas (MIA) of This DOT

20 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Hepatocellular carcinoma	DIS0J828	Definitive	Biomarker	[1]
Liver cancer	DISDE4BI	Definitive	Biomarker	[1]
Tuberculosis	DIS2YIMD	Definitive	Biomarker	[2]
Analgesia	DISK3TVI	Strong	Biomarker	[3]
Ankylosing spondylitis	DISRC6IR	Strong	Biomarker	[4]
Atopic dermatitis	DISTCP41	Strong	Genetic Variation	[5]
Cleft lip	DISV3XW6	Strong	Genetic Variation	[6]
Dementia	DISXL1WY	Strong	Genetic Variation	[7]
Depression	DIS3XJ69	Strong	Biomarker	[8]
Familial adenomatous polyposis 2	DIS62W3Y	Strong	Biomarker	[9]
Hypertrophic cardiomyopathy	DISQG2AI	Strong	Biomarker	[10]
Isolated cleft lip	DIS2O2JV	Strong	Genetic Variation	[6]
Neoplasm	DISZKGEW	Strong	Biomarker	[11]
Nervous system inflammation	DISB3X5A	Strong	Biomarker	[9]
Neuralgia	DISWO58J	Strong	Biomarker	[12]
Prostatitis	DISL8OGN	Strong	Biomarker	[13]
Rheumatoid arthritis	DISTSB4J	moderate	Biomarker	[14]
Arthritis	DIST1YEL	Limited	Biomarker	[15]
Diphtheria	DISZWM55	Limited	Altered Expression	[16]
Psychotic disorder	DIS4UQOT	Limited	Biomarker	[17]

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Tubulin-specific chaperone A (TBCA).	[18]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Tubulin-specific chaperone A (TBCA).	[19]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Tubulin-specific chaperone A (TBCA).	[20]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Tubulin-specific chaperone A (TBCA).	[21]
PMID28870136-Compound-48	DMPIM9L	Patented	PMID28870136-Compound-48 increases the expression of Tubulin-specific chaperone A (TBCA).	[22]
chloropicrin	DMSGBQA	Investigative	chloropicrin affects the expression of Tubulin-specific chaperone A (TBCA).	[23]

References

• [1] [(18)F] Clofarabine for PET Imaging of Hepatocellular Carcinoma.Cancers (Basel). 2019 Nov 7;11(11):1748. doi: 10.3390/cancers11111748.
• [2] Ras Signaling Inhibitors Attenuate Disease in Adjuvant-Induced Arthritis via Targeting Pathogenic Antigen-Specific Th17-Type Cells.Front Immunol. 2017 Jul 7;8:799. doi: 10.3389/fimmu.2017.00799. eCollection 2017.
• [3] Involvement of glycine receptor 1 subunits in cannabinoid-induced analgesia.Neuropharmacology. 2018 May 1;133:224-232. doi: 10.1016/j.neuropharm.2018.01.041. Epub 2018 Feb 1.
• [4] Genome-wide DNA methylation analysis in ankylosing spondylitis identifies HLA-B*27 dependent and independent DNA methylation changes in whole blood.J Autoimmun. 2019 Aug;102:126-132. doi: 10.1016/j.jaut.2019.04.022. Epub 2019 May 23.
• [5] Genome-wide analysis in German shepherd dogs reveals association of a locus on CFA 27 with atopic dermatitis.PLoS Genet. 2013 May;9(5):e1003475. doi: 10.1371/journal.pgen.1003475. Epub 2013 May 9.
• [6] Psychosocial Adjustments Among Adolescents With Craniofacial Conditions and the Influence of Social Factors: A Multi-Informant Study.Cleft Palate Craniofac J. 2020 May;57(5):624-636. doi: 10.1177/1055665619888308. Epub 2019 Nov 26.
• [7] APOE and ACE polymorphisms and dementia risk in the older population over prolonged follow-up: 10 years of incidence in the MRC CFA Study.Age Ageing. 2010 Jan;39(1):104-11. doi: 10.1093/ageing/afp210. Epub 2009 Nov 24.
• [8] Development and initial validation of the job loss grief scale.Anxiety Stress Coping. 2019 Jul;32(4):428-442. doi: 10.1080/10615806.2019.1619703. Epub 2019 May 19.
• [9] Adjuvant and antigenic properties of Mycobacterium avium subsp. paratuberculosis on experimental autoimmune encephalomyelitis.J Neuroimmunol. 2019 May 15;330:174-177. doi: 10.1016/j.jneuroim.2019.01.013. Epub 2019 Jan 23.
• [10] An integrated approach to proteome analysis: identification of proteins associated with cardiac hypertrophy.Anal Biochem. 1998 Apr 10;258(1):1-18. doi: 10.1006/abio.1998.2566.
• [11] Development and preclinical pharmacology of a novel dCK inhibitor, DI-87.Biochem Pharmacol. 2020 Feb;172:113742. doi: 10.1016/j.bcp.2019.113742. Epub 2019 Dec 6.
• [12] Involvement of substance P in the antinociceptive effect of botulinum toxin type A: Evidence from knockout mice.Neuroscience. 2017 Sep 1;358:137-145. doi: 10.1016/j.neuroscience.2017.06.040. Epub 2017 Jul 1.
• [13] Establishment of a rat model of chronic Prostatitis/Chronic Pelvic Pain Syndrome (CP/CPPS) induced by immunization with a novel peptide T2.Biomed Pharmacother. 2017 Jul;91:687-692. doi: 10.1016/j.biopha.2017.05.004. Epub 2017 May 9.
• [14] Pain Relieving Effect of-NSAIDs-CAIs Hybrid Molecules: Systemic and Intra-Articular Treatments against Rheumatoid Arthritis.Int J Mol Sci. 2019 Apr 18;20(8):1923. doi: 10.3390/ijms20081923.
• [15] Photobiostimulation activity of different low-level laser dosage on masticatory muscles and temporomandibular joint in an induced arthritis rat model.Lasers Med Sci. 2020 Jul;35(5):1129-1139. doi: 10.1007/s10103-019-02933-y. Epub 2019 Dec 13.
• [16] Conditional DC depletion does not affect priming of encephalitogenic Th cells in EAE.Eur J Immunol. 2012 Oct;42(10):2555-63. doi: 10.1002/eji.201142239. Epub 2012 Aug 8.
• [17] Evaluating verbal learning and memory in patients with an at-risk mental state or first episode psychosis using structural equation modelling.PLoS One. 2018 May 10;13(5):e0196936. doi: 10.1371/journal.pone.0196936. eCollection 2018.
• [18] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [19] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [20] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [21] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [22] Oxidative stress modulates theophylline effects on steroid responsiveness. Biochem Biophys Res Commun. 2008 Dec 19;377(3):797-802.
• [23] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.