Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTEJCYMY)

• DOT Name: C-X-C motif chemokine 2 (CXCL2)
• Synonyms: Growth-regulated protein beta; Gro-beta; Macrophage inflammatory protein 2-alpha; MIP2-alpha
• Gene Name: CXCL2
• UniProt ID: CXCL2_HUMAN
• PDB ID: 1QNK; 5OB5
• Pfam ID: PF00048
• Sequence:
  MARATLSAAPSNPRLLRVALLLLLLVAASRRAAGAPLATELRCQCLQTLQGIHLKNIQSV
  KVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
• Function: Produced by activated monocytes and neutrophils and expressed at sites of inflammation. Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. GRO-beta(5-73) shows a highly enhanced hematopoietic activity.
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  Viral protein interaction with cytokine and cytokine receptor (hsa04061)
  Chemokine sig.ling pathway (hsa04062)
  NF-kappa B sig.ling pathway (hsa04064)
  NOD-like receptor sig.ling pathway (hsa04621)
  IL-17 sig.ling pathway (hsa04657)
  TNF sig.ling pathway (hsa04668)
  Alcoholic liver disease (hsa04936)
  Epithelial cell sig.ling in Helicobacter pylori infection (hsa05120)
  Legionellosis (hsa05134)
  Amoebiasis (hsa05146)
  Kaposi sarcoma-associated herpesvirus infection (hsa05167)
  Rheumatoid arthritis (hsa05323)
  Lipid and atherosclerosis (hsa05417)
• Reactome Pathway:
  G alpha (i) signalling events (R-HSA-418594)
  Interleukin-10 signaling (R-HSA-6783783)
  Chemokine receptors bind chemokines (R-HSA-380108)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
DTI-015	DMXZRW0	Approved	C-X-C motif chemokine 2 (CXCL2) affects the response to substance of DTI-015.	[43]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of C-X-C motif chemokine 2 (CXCL2).	[1]

47 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of C-X-C motif chemokine 2 (CXCL2).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of C-X-C motif chemokine 2 (CXCL2).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of C-X-C motif chemokine 2 (CXCL2).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of C-X-C motif chemokine 2 (CXCL2).	[5]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of C-X-C motif chemokine 2 (CXCL2).	[6]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of C-X-C motif chemokine 2 (CXCL2).	[7]
Arsenic	DMTL2Y1	Approved	Arsenic decreases the expression of C-X-C motif chemokine 2 (CXCL2).	[8]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of C-X-C motif chemokine 2 (CXCL2).	[9]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of C-X-C motif chemokine 2 (CXCL2).	[11]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of C-X-C motif chemokine 2 (CXCL2).	[12]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of C-X-C motif chemokine 2 (CXCL2).	[13]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of C-X-C motif chemokine 2 (CXCL2).	[14]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of C-X-C motif chemokine 2 (CXCL2).	[15]
Selenium	DM25CGV	Approved	Selenium increases the expression of C-X-C motif chemokine 2 (CXCL2).	[16]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of C-X-C motif chemokine 2 (CXCL2).	[13]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of C-X-C motif chemokine 2 (CXCL2).	[17]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of C-X-C motif chemokine 2 (CXCL2).	[18]
Troglitazone	DM3VFPD	Approved	Troglitazone increases the expression of C-X-C motif chemokine 2 (CXCL2).	[19]
Nicotine	DMWX5CO	Approved	Nicotine decreases the expression of C-X-C motif chemokine 2 (CXCL2).	[20]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of C-X-C motif chemokine 2 (CXCL2).	[21]
Amphotericin B	DMTAJQE	Approved	Amphotericin B increases the expression of C-X-C motif chemokine 2 (CXCL2).	[22]
Gemcitabine	DMSE3I7	Approved	Gemcitabine increases the expression of C-X-C motif chemokine 2 (CXCL2).	[23]
Methamphetamine	DMPM4SK	Approved	Methamphetamine increases the expression of C-X-C motif chemokine 2 (CXCL2).	[24]
Prednisolone	DMQ8FR2	Approved	Prednisolone decreases the expression of C-X-C motif chemokine 2 (CXCL2).	[21]
Diphenylpyraline	DMW4X37	Approved	Diphenylpyraline decreases the expression of C-X-C motif chemokine 2 (CXCL2).	[25]
Ritonavir	DMU764S	Approved	Ritonavir decreases the expression of C-X-C motif chemokine 2 (CXCL2).	[26]
Methylprednisolone	DM4BDON	Approved	Methylprednisolone decreases the expression of C-X-C motif chemokine 2 (CXCL2).	[21]
Bleomycin	DMNER5S	Approved	Bleomycin increases the expression of C-X-C motif chemokine 2 (CXCL2).	[27]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of C-X-C motif chemokine 2 (CXCL2).	[28]
Curcumin	DMQPH29	Phase 3	Curcumin decreases the expression of C-X-C motif chemokine 2 (CXCL2).	[29]
Fenretinide	DMRD5SP	Phase 3	Fenretinide increases the expression of C-X-C motif chemokine 2 (CXCL2).	[30]
HMPL-004	DM29XGY	Phase 3	HMPL-004 increases the expression of C-X-C motif chemokine 2 (CXCL2).	[31]
Bardoxolone methyl	DMODA2X	Phase 3	Bardoxolone methyl increases the expression of C-X-C motif chemokine 2 (CXCL2).	[31]
DNCB	DMDTVYC	Phase 2	DNCB increases the expression of C-X-C motif chemokine 2 (CXCL2).	[32]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of C-X-C motif chemokine 2 (CXCL2).	[20]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of C-X-C motif chemokine 2 (CXCL2).	[33]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of C-X-C motif chemokine 2 (CXCL2).	[34]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of C-X-C motif chemokine 2 (CXCL2).	[31]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of C-X-C motif chemokine 2 (CXCL2).	[35]
Paraquat	DMR8O3X	Investigative	Paraquat increases the expression of C-X-C motif chemokine 2 (CXCL2).	[36]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of C-X-C motif chemokine 2 (CXCL2).	[37]
Phencyclidine	DMQBEYX	Investigative	Phencyclidine increases the expression of C-X-C motif chemokine 2 (CXCL2).	[38]
Manganese	DMKT129	Investigative	Manganese increases the expression of C-X-C motif chemokine 2 (CXCL2).	[39]
Resorcinol	DMM37C0	Investigative	Resorcinol decreases the expression of C-X-C motif chemokine 2 (CXCL2).	[40]
crotylaldehyde	DMTWRQI	Investigative	crotylaldehyde decreases the expression of C-X-C motif chemokine 2 (CXCL2).	[41]
Bilirubin	DMI0V4O	Investigative	Bilirubin increases the expression of C-X-C motif chemokine 2 (CXCL2).	[42]
2-tert-butylbenzene-1,4-diol	DMNXI1E	Investigative	2-tert-butylbenzene-1,4-diol increases the expression of C-X-C motif chemokine 2 (CXCL2).	[31]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Temozolomide	DMKECZD	Approved	Temozolomide decreases the secretion of C-X-C motif chemokine 2 (CXCL2).	[10]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [3] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [6] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [7] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [8] Gene expression profiles in peripheral lymphocytes by arsenic exposure and skin lesion status in a Bangladeshi population. Cancer Epidemiol Biomarkers Prev. 2006 Jul;15(7):1367-75. doi: 10.1158/1055-9965.EPI-06-0106.
• [9] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [10] Considering temozolomide as a novel potential treatment for esophageal cancer. Cancer. 2011 May 1;117(9):2004-16. doi: 10.1002/cncr.25687. Epub 2010 Nov 8.
• [11] Global effects of inorganic arsenic on gene expression profile in human macrophages. Mol Immunol. 2009 Feb;46(4):649-56.
• [12] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [13] Progesterone and calcitriol attenuate inflammatory cytokines CXCL1 and CXCL2 in ovarian and endometrial cancer cells. J Cell Biochem. 2012 Oct;113(10):3143-52. doi: 10.1002/jcb.24191.
• [14] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [15] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [16] Changes in gene expression profiles in response to selenium supplementation among individuals with arsenic-induced pre-malignant skin lesions. Toxicol Lett. 2007 Mar 8;169(2):162-76. doi: 10.1016/j.toxlet.2007.01.006. Epub 2007 Jan 19.
• [17] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [18] Cannabidiol enhances cytotoxicity of anti-cancer drugs in human head and neck squamous cell carcinoma. Sci Rep. 2020 Nov 26;10(1):20622. doi: 10.1038/s41598-020-77674-y.
• [19] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [20] Effects of tobacco compounds on gene expression in fetal lung fibroblasts. Environ Toxicol. 2008 Aug;23(4):423-34.
• [21] Antirheumatic drug response signatures in human chondrocytes: potential molecular targets to stimulate cartilage regeneration. Arthritis Res Ther. 2009;11(1):R15.
• [22] Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
• [23] Gene expression profiling of breast cancer cells in response to gemcitabine: NF-kappaB pathway activation as a potential mechanism of resistance. Breast Cancer Res Treat. 2007 Apr;102(2):157-72.
• [24] Methamphetamine alters the normal progression by inducing cell cycle arrest in astrocytes. PLoS One. 2014 Oct 7;9(10):e109603.
• [25] Controlled diesel exhaust and allergen coexposure modulates microRNA and gene expression in humans: Effects on inflammatory lung markers. J Allergy Clin Immunol. 2016 Dec;138(6):1690-1700. doi: 10.1016/j.jaci.2016.02.038. Epub 2016 Apr 24.
• [26] Transcriptional profiling suggests that Nevirapine and Ritonavir cause drug induced liver injury through distinct mechanisms in primary human hepatocytes. Chem Biol Interact. 2016 Aug 5;255:31-44.
• [27] Agents associated with lung inflammation induce similar responses in NCI-H292 lung epithelial cells. Toxicol In Vitro. 2008 Oct;22(7):1782-8.
• [28] Grape resveratrol increases serum adiponectin and downregulates inflammatory genes in peripheral blood mononuclear cells: a triple-blind, placebo-controlled, one-year clinical trial in patients with stable coronary artery disease. Cardiovasc Drugs Ther. 2013 Feb;27(1):37-48. doi: 10.1007/s10557-012-6427-8.
• [29] Curcumin downregulates the inflammatory cytokines CXCL1 and -2 in breast cancer cells via NFkappaB. Carcinogenesis. 2008 Apr;29(4):779-89.
• [30] The transforming growth factor-beta family members bone morphogenetic protein-2 and macrophage inhibitory cytokine-1 as mediators of the antiangiogenic activity of N-(4-hydroxyphenyl)retinamide. Clin Cancer Res. 2005 Jun 15;11(12):4610-9.
• [31] Mapping the dynamics of Nrf2 antioxidant and NFB inflammatory responses by soft electrophilic chemicals in human liver cells defines the transition from adaptive to adverse responses. Toxicol In Vitro. 2022 Oct;84:105419. doi: 10.1016/j.tiv.2022.105419. Epub 2022 Jun 17.
• [32] Upregulation of genes orchestrating keratinocyte differentiation, including the novel marker gene ID2, by contact sensitizers in human bulge-derived keratinocytes. J Biochem Mol Toxicol. 2010 Jan-Feb;24(1):10-20.
• [33] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [34] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [35] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
• [36] CD34+ derived macrophage and dendritic cells display differential responses to paraquat. Toxicol In Vitro. 2021 Sep;75:105198. doi: 10.1016/j.tiv.2021.105198. Epub 2021 Jun 9.
• [37] The contact allergen nickel triggers a unique inflammatory and proangiogenic gene expression pattern via activation of NF-kappaB and hypoxia-inducible factor-1alpha. J Immunol. 2007 Mar 1;178(5):3198-207.
• [38] Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.
• [39] Gene expression profiling of human primary astrocytes exposed to manganese chloride indicates selective effects on several functions of the cells. Neurotoxicology. 2007 May;28(3):478-89.
• [40] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [41] Gene expression profile and cytotoxicity of human bronchial epithelial cells exposed to crotonaldehyde. Toxicol Lett. 2010 Aug 16;197(2):113-22.
• [42] Global changes in gene regulation demonstrate that unconjugated bilirubin is able to upregulate and activate select components of the endoplasmic reticulum stress response pathway. J Biochem Mol Toxicol. 2010 Mar-Apr;24(2):73-88.
• [43] Tumor necrosis factor-alpha-induced protein 3 as a putative regulator of nuclear factor-kappaB-mediated resistance to O6-alkylating agents in human glioblastomas. J Clin Oncol. 2006 Jan 10;24(2):274-87. doi: 10.1200/JCO.2005.02.9405. Epub 2005 Dec 19.