Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTFTNFHW)

• DOT Name: SOSS complex subunit B2 (NABP1)
• Synonyms: Nucleic acid-binding protein 1; Oligonucleotide/oligosaccharide-binding fold-containing protein 2A; Sensor of single-strand DNA complex subunit B2; Sensor of ssDNA subunit B2; SOSS-B2; Single-stranded DNA-binding protein 2; hSSB2
• Gene Name: NABP1
• Related Disease:
  Breast cancer
  Breast carcinoma
  Colorectal neoplasm
  Esophageal squamous cell carcinoma
  Neoplasm
  Promyelocytic leukaemia
  Laryngeal squamous cell carcinoma
  Hepatocellular carcinoma
• UniProt ID: SOSB2_HUMAN
• Pfam ID: PF21473
• Sequence:
  MNRVNDPLIFIRDIKPGLKNLNVVFIVLEIGRVTKTKDGHEVRSCKVADKTGSITISVWD
  EIGGLIQPGDIIRLTRGYASMWKGCLTLYTGRGGELQKIGEFCMVYSEVPNFSEPNPDYR
  GQQNKGAQSEQKNNSMNSNMGTGTFGPVGNGVHTGPESREHQFSHAGRSNGRGLINPQLQ
  GTASNQTVMTTISNGRDPRRAFKR
• Function: Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint. In the SOSS complex, acts as a sensor of single-stranded DNA that binds to single-stranded DNA, in particular to polypyrimidines. The SOSS complex associates with DNA lesions and influences diverse endpoints in the cellular DNA damage response including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. Required for efficient homologous recombination-dependent repair of double-strand breaks (DSBs) and ATM-dependent signaling pathways.
• Reactome Pathway: RNA polymerase II transcribes snRNA genes (R-HSA-6807505)

Molecular Interaction Atlas (MIA) of This DOT

8 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Breast cancer	DIS7DPX1	Strong	Biomarker	[1]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[1]
Colorectal neoplasm	DISR1UCN	Strong	Genetic Variation	[2]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Posttranslational Modification	[3]
Neoplasm	DISZKGEW	Strong	Biomarker	[4]
Promyelocytic leukaemia	DISYGG13	Strong	FusionGene	[5]
Laryngeal squamous cell carcinoma	DIS9UUVF	moderate	Genetic Variation	[6]
Hepatocellular carcinoma	DIS0J828	Limited	Altered Expression	[7]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Fluorouracil	DMUM7HZ	Approved	SOSS complex subunit B2 (NABP1) increases the Neutropenia ADR of Fluorouracil.	[37]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of SOSS complex subunit B2 (NABP1).	[8]

30 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of SOSS complex subunit B2 (NABP1).	[9]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of SOSS complex subunit B2 (NABP1).	[10]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of SOSS complex subunit B2 (NABP1).	[11]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of SOSS complex subunit B2 (NABP1).	[12]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of SOSS complex subunit B2 (NABP1).	[13]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of SOSS complex subunit B2 (NABP1).	[14]
Estradiol	DMUNTE3	Approved	Estradiol affects the expression of SOSS complex subunit B2 (NABP1).	[15]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of SOSS complex subunit B2 (NABP1).	[16]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of SOSS complex subunit B2 (NABP1).	[17]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of SOSS complex subunit B2 (NABP1).	[18]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of SOSS complex subunit B2 (NABP1).	[19]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of SOSS complex subunit B2 (NABP1).	[20]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of SOSS complex subunit B2 (NABP1).	[21]
Marinol	DM70IK5	Approved	Marinol decreases the expression of SOSS complex subunit B2 (NABP1).	[22]
Menadione	DMSJDTY	Approved	Menadione affects the expression of SOSS complex subunit B2 (NABP1).	[18]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of SOSS complex subunit B2 (NABP1).	[19]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of SOSS complex subunit B2 (NABP1).	[23]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of SOSS complex subunit B2 (NABP1).	[24]
Bortezomib	DMNO38U	Approved	Bortezomib increases the expression of SOSS complex subunit B2 (NABP1).	[25]
Azathioprine	DMMZSXQ	Approved	Azathioprine increases the expression of SOSS complex subunit B2 (NABP1).	[26]
Indomethacin	DMSC4A7	Approved	Indomethacin increases the expression of SOSS complex subunit B2 (NABP1).	[27]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of SOSS complex subunit B2 (NABP1).	[28]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of SOSS complex subunit B2 (NABP1).	[29]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of SOSS complex subunit B2 (NABP1).	[30]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of SOSS complex subunit B2 (NABP1).	[31]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of SOSS complex subunit B2 (NABP1).	[32]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of SOSS complex subunit B2 (NABP1).	[33]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of SOSS complex subunit B2 (NABP1).	[34]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde decreases the expression of SOSS complex subunit B2 (NABP1).	[35]
Paraquat	DMR8O3X	Investigative	Paraquat increases the expression of SOSS complex subunit B2 (NABP1).	[36]

References

• [1] Antitumor effects of saikosaponin b2 on breast cancer cell proliferation and migration.Mol Med Rep. 2019 Aug;20(2):1943-1951. doi: 10.3892/mmr.2019.10385. Epub 2019 Jun 13.
• [2] Identification of Genetic Susceptibility Loci for Colorectal Tumors in a Genome-Wide Meta-analysis.Gastroenterology. 2013 Apr;144(4):799-807.e24. doi: 10.1053/j.gastro.2012.12.020. Epub 2012 Dec 22.
• [3] Cigarette smoke induces promoter methylation of single-stranded DNA-binding protein 2 in human esophageal squamous cell carcinoma.Int J Cancer. 2011 May 15;128(10):2261-73. doi: 10.1002/ijc.25569.
• [4] Crystal structure of the LUFS domain of human single-stranded DNA binding Protein 2 (SSBP2).Protein Sci. 2019 Apr;28(4):788-793. doi: 10.1002/pro.3581. Epub 2019 Feb 12.
• [5] OBFC2A/RARA: a novel fusion gene in variant acute promyelocytic leukemia.Blood. 2013 Feb 21;121(8):1432-5. doi: 10.1182/blood-2012-04-423129. Epub 2013 Jan 3.
• [6] DIRC3 and near NABP1 genetic polymorphisms are associated laryngeal squamous cell carcinoma patient survival.Oncotarget. 2016 Nov 29;7(48):79596-79604. doi: 10.18632/oncotarget.12865.
• [7] Single-stranded DNA binding protein 2 expression is associated with patient survival in hepatocellular carcinoma.BMC Cancer. 2018 Dec 12;18(1):1244. doi: 10.1186/s12885-018-5158-z.
• [8] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [9] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [10] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [11] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [12] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [13] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [14] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [15] Identification of novel low-dose bisphenol a targets in human foreskin fibroblast cells derived from hypospadias patients. PLoS One. 2012;7(5):e36711. doi: 10.1371/journal.pone.0036711. Epub 2012 May 4.
• [16] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [17] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [18] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [19] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [20] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [21] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [22] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [23] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [24] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [25] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [26] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [27] Evaluation of developmental toxicity using undifferentiated human embryonic stem cells. J Appl Toxicol. 2015 Feb;35(2):205-18.
• [28] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [29] Resveratrol inhibits pancreatic cancer cell proliferation through transcriptional induction of macrophage inhibitory cytokine-1. J Surg Res. 2007 Apr;138(2):163-9. doi: 10.1016/j.jss.2006.05.037. Epub 2007 Jan 25.
• [30] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [31] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [32] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [33] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [34] Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
• [35] In vitro effects of aldehydes present in tobacco smoke on gene expression in human lung alveolar epithelial cells. Toxicol In Vitro. 2013 Apr;27(3):1072-81.
• [36] Paraquat modulates alternative pre-mRNA splicing by modifying the intracellular distribution of SRPK2. PLoS One. 2013 Apr 16;8(4):e61980. doi: 10.1371/journal.pone.0061980. Print 2013.
• [37] Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan. Cancer Sci. 2013 Aug;104(8):1074-82. doi: 10.1111/cas.12186. Epub 2013 Jun 10.