Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTG3JNOQ)

• DOT Name: Probable helicase senataxin (SETX)
• Synonyms: EC 3.6.4.-; Amyotrophic lateral sclerosis 4 protein; SEN1 homolog; Senataxin
• Gene Name: SETX
• Related Disease:
  Amyotrophic lateral sclerosis type 4
  Anaplastic astrocytoma
  Distal hereditary motor neuropathy
  Microcephaly with or without chorioretinopathy, lymphedema, or intellectual disability
  Spinocerebellar ataxia, autosomal recessive, with axonal neuropathy 2
  Adult lymphoma
  Advanced cancer
  Alzheimer disease
  Ataxia, early-onset, with oculomotor apraxia and hypoalbuminemia
  Ataxia-telangiectasia-like disorder
  Ataxia-telangiectasia-like disorder 1
  Azoospermia
  Charcot marie tooth disease
  Charlevoix-Saguenay spastic ataxia
  Dystonia
  Familial isolated deficiency of vitamin E
  Friedreich ataxia 1
  Friedreich's ataxia
  Hereditary ataxia
  Hypogonadism
  leukaemia
  Leukemia
  Lung adenocarcinoma
  Lymphoma
  Motor neurone disease
  Movement disorder
  Nervous system disease
  Oligospermia
  Pediatric lymphoma
  Polyneuropathy
  Prostate cancer
  Prostate carcinoma
  Proximal spinal muscular atrophy
  Schwartz-Jampel syndrome
  Spinal muscular atrophy
  Toxic epidermal necrolysis
  Trichohepatoenteric syndrome
  Tuberculosis
  Female hypogonadism
  Frontotemporal dementia
  Juvenile amyotrophic lateral sclerosis
  Spinocerebellar ataxia type 31
  Amyotrophic lateral sclerosis type 2, juvenile
  Congenital generalized lipodystrophy
  Peripheral neuropathy
  Progressive supranuclear palsy
• UniProt ID: SETX_HUMAN
• EC Number: 3.6.4.-
• Pfam ID: PF13086 ; PF13087
• Sequence:
  MSTCCWCTPGGASTIDFLKRYASNTPSGEFQTADEDLCYCLECVAEYHKARDELPFLHEV
  LWELETLRLINHFEKSMKAEIGDDDELYIVDNNGEMPLFDITGQDFENKLRVPLLEILKY
  PYLLLHERVNELCVEALCRMEQANCSFQVFDKHPGIYLFLVHPNEMVRRWAILTARNLGK
  VDRDDYYDLQEVLLCLFKVIELGLLESPDIYTSSVLEKGKLILLPSHMYDTTNYKSYWLG
  ICMLLTILEEQAMDSLLLGSDKQNDFMQSILHTMEREADDDSVDPFWPALHCFMVILDRL
  GSKVWGQLMDPIVAFQTIINNASYNREIRHIRNSSVRTKLEPESYLDDMVTCSQIVYNYN
  PEKTKKDSGWRTAICPDYCPNMYEEMETLASVLQSDIGQDMRVHNSTFLWFIPFVQSLMD
  LKDLGVAYIAQVVNHLYSEVKEVLNQTDAVCDKVTEFFLLILVSVIELHRNKKCLHLLWV
  SSQQWVEAVVKCAKLPTTAFTRSSEKSSGNCSKGTAMISSLSLHSMPSNSVQLAYVQLIR
  SLLKEGYQLGQQSLCKRFWDKLNLFLRGNLSLGWQLTSQETHELQSCLKQIIRNIKFKAP
  PCNTFVDLTSACKISPASYNKEESEQMGKTSRKDMHCLEASSPTFSKEPMKVQDSVLIKA
  DNTIEGDNNEQNYIKDVKLEDHLLAGSCLKQSSKNIFTERAEDQIKISTRKQKSVKEISS
  YTPKDCTSRNGPERGCDRGIIVSTRLLTDSSTDALEKVSTSNEDFSLKDDALAKTSKRKT
  KVQKDEICAKLSHVIKKQHRKSTLVDNTINLDENLTVSNIESFYSRKDTGVQKGDGFIHN
  LSLDPSGVLDDKNGEQKSQNNVLPKEKQLKNEELVIFSFHENNCKIQEFHVDGKELIPFT
  EMTNASEKKSSPFKDLMTVPESRDEEMSNSTSVIYSNLTREQAPDISPKSDTLTDSQIDR
  DLHKLSLLAQASVITFPSDSPQNSSQLQRKVKEDKRCFTANQNNVGDTSRGQVIIISDSD
  DDDDERILSLEKLTKQDKICLEREHPEQHVSTVNSKEEKNPVKEEKTETLFQFEESDSQC
  FEFESSSEVFSVWQDHPDDNNSVQDGEKKCLAPIANTTNGQGCTDYVSEVVKKGAEGIEE
  HTRPRSISVEEFCEIEVKKPKRKRSEKPMAEDPVRPSSSVRNEGQSDTNKRDLVGNDFKS
  IDRRTSTPNSRIQRATTVSQKKSSKLCTCTEPIRKVPVSKTPKKTHSDAKKGQNRSSNYL
  SCRTTPAIVPPKKFRQCPEPTSTAEKLGLKKGPRKAYELSQRSLDYVAQLRDHGKTVGVV
  DTRKKTKLISPQNLSVRNNKKLLTSQELQMQRQIRPKSQKNRRRLSDCESTDVKRAGSHT
  AQNSDIFVPESDRSDYNCTGGTEVLANSNRKQLIKCMPSEPETIKAKHGSPATDDACPLN
  QCDSVVLNGTVPTNEVIVSTSEDPLGGGDPTARHIEMAALKEGEPDSSSDAEEDNLFLTQ
  NDPEDMDLCSQMENDNYKLIELIHGKDTVEVEEDSVSRPQLESLSGTKCKYKDCLETTKN
  QGEYCPKHSEVKAADEDVFRKPGLPPPASKPLRPTTKIFSSKSTSRIAGLSKSLETSSAL
  SPSLKNKSKGIQSILKVPQPVPLIAQKPVGEMKNSCNVLHPQSPNNSNRQGCKVPFGESK
  YFPSSSPVNILLSSQSVSDTFVKEVLKWKYEMFLNFGQCGPPASLCQSISRPVPVRFHNY
  GDYFNVFFPLMVLNTFETVAQEWLNSPNRENFYQLQVRKFPADYIKYWEFAVYLEECELA
  KQLYPKENDLVFLAPERINEEKKDTERNDIQDLHEYHSGYVHKFRRTSVMRNGKTECYLS
  IQTQENFPANLNELVNCIVISSLVTTQRKLKAMSLLGSRNQLARAVLNPNPMDFCTKDLL
  TTTSERIIAYLRDFNEDQKKAIETAYAMVKHSPSVAKICLIHGPPGTGKSKTIVGLLYRL
  LTENQRKGHSDENSNAKIKQNRVLVCAPSNAAVDELMKKIILEFKEKCKDKKNPLGNCGD
  INLVRLGPEKSINSEVLKFSLDSQVNHRMKKELPSHVQAMHKRKEFLDYQLDELSRQRAL
  CRGGREIQRQELDENISKVSKERQELASKIKEVQGRPQKTQSIIILESHIICCTLSTSGG
  LLLESAFRGQGGVPFSCVIVDEAGQSCEIETLTPLIHRCNKLILVGDPKQLPPTVISMKA
  QEYGYDQSMMARFCRLLEENVEHNMISRLPILQLTVQYRMHPDICLFPSNYVYNRNLKTN
  RQTEAIRCSSDWPFQPYLVFDVGDGSERRDNDSYINVQEIKLVMEIIKLIKDKRKDVSFR
  NIGIITHYKAQKTMIQKDLDKEFDRKGPAEVDTVDAFQGRQKDCVIVTCVRANSIQGSIG
  FLASLQRLNVTITRAKYSLFILGHLRTLMENQHWNQLIQDAQKRGAIIKTCDKNYRHDAV
  KILKLKPVLQRSLTHPPTIAPEGSRPQGGLPSSKLDSGFAKTSVAASLYHTPSDSKEITL
  TVTSKDPERPPVHDQLQDPRLLKRMGIEVKGGIFLWDPQPSSPQHPGATPPTGEPGFPVV
  HQDLSHIQQPAAVVAALSSHKPPVRGEPPAASPEASTCQSKCDDPEEELCHRREARAFSE
  GEQEKCGSETHHTRRNSRWDKRTLEQEDSSSKKRKLL
• Function: Probable RNA/DNA helicase involved in diverse aspects of RNA metabolism and genomic integrity. Plays a role in transcription regulation by its ability to modulate RNA Polymerase II (Pol II) binding to chromatin and through its interaction with proteins involved in transcription. Contributes to the mRNA splicing efficiency and splice site selection. Required for the resolution of R-loop RNA-DNA hybrid formation at G-rich pause sites located downstream of the poly(A) site, allowing XRN2 recruitment and XRN2-mediated degradation of the downstream cleaved RNA and hence efficient RNA polymerase II (RNAp II) transcription termination. Required for the 3' transcriptional termination of PER1 and CRY2, thus playing an important role in the circadian rhythm regulation. Involved in DNA double-strand breaks damage response generated by oxidative stress. In association with RRP45, targets the RNA exosome complex to sites of transcription-induced DNA damage. Plays a role in the development and maturation of germ cells: essential for male meiosis, acting at the interface of transcription and meiotic recombination, and in the process of gene silencing during meiotic sex chromosome inactivation (MSCI). May be involved in telomeric stability through the regulation of telomere repeat-containing RNA (TERRA) transcription. Plays a role in neurite outgrowth in hippocampal cells through FGF8-activated signaling pathways. Inhibits retinoic acid-induced apoptosis.
• Tissue Specificity: Highly expressed in skeletal muscle. Expressed in heart, fibroblast, placenta and liver. Weakly expressed in brain and lung. Expressed in the cortex of the kidney (highly expressed in tubular epithelial cells but low expression in the glomerulus).
• KEGG Pathway: Amyotrophic lateral sclerosis (hsa05014)

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Amyotrophic lateral sclerosis type 4	DISSDHYG	Definitive	Autosomal dominant	[1]
Anaplastic astrocytoma	DISSBE0K	Definitive	Biomarker	[2]
Distal hereditary motor neuropathy	DISGS2ID	Definitive	Autosomal dominant	[3]
Microcephaly with or without chorioretinopathy, lymphedema, or intellectual disability	DISFHDE1	Definitive	Genetic Variation	[4]
Spinocerebellar ataxia, autosomal recessive, with axonal neuropathy 2	DIS84UUI	Definitive	Autosomal recessive	[1]
Adult lymphoma	DISK8IZR	Strong	Biomarker	[5]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[5]
Alzheimer disease	DISF8S70	Strong	Genetic Variation	[6]
Ataxia, early-onset, with oculomotor apraxia and hypoalbuminemia	DIS8CFD7	Strong	Genetic Variation	[7]
Ataxia-telangiectasia-like disorder	DIS98DFM	Strong	Genetic Variation	[8]
Ataxia-telangiectasia-like disorder 1	DISKHZ2U	Strong	Genetic Variation	[8]
Azoospermia	DIS94181	Strong	Genetic Variation	[9]
Charcot marie tooth disease	DIS3BT2L	Strong	Biomarker	[10]
Charlevoix-Saguenay spastic ataxia	DISE8X81	Strong	Genetic Variation	[11]
Dystonia	DISJLFGW	Strong	Genetic Variation	[12]
Familial isolated deficiency of vitamin E	DIS53306	Strong	Genetic Variation	[11]
Friedreich ataxia 1	DIS285GE	Strong	Biomarker	[13]
Friedreich's ataxia	DIS5DV35	Strong	Biomarker	[14]
Hereditary ataxia	DIS6JNI3	Strong	Biomarker	[10]
Hypogonadism	DISICMNI	Strong	Biomarker	[15]
leukaemia	DISS7D1V	Strong	Biomarker	[5]
Leukemia	DISNAKFL	Strong	Biomarker	[5]
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[16]
Lymphoma	DISN6V4S	Strong	Biomarker	[5]
Motor neurone disease	DISUHWUI	Strong	Biomarker	[17]
Movement disorder	DISOJJ2D	Strong	Genetic Variation	[12]
Nervous system disease	DISJ7GGT	Strong	Biomarker	[18]
Oligospermia	DIS6YJF3	Strong	Genetic Variation	[9]
Pediatric lymphoma	DIS51BK2	Strong	Biomarker	[5]
Polyneuropathy	DISB9G3W	Strong	Biomarker	[19]
Prostate cancer	DISF190Y	Strong	Biomarker	[20]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[20]
Proximal spinal muscular atrophy	DIS0R70E	Strong	Genetic Variation	[21]
Schwartz-Jampel syndrome	DIS3HCR8	Strong	Biomarker	[22]
Spinal muscular atrophy	DISTLKOB	Strong	Altered Expression	[23]
Toxic epidermal necrolysis	DISIWPFR	Strong	Biomarker	[22]
Trichohepatoenteric syndrome	DISL3ODF	Strong	Biomarker	[6]
Tuberculosis	DIS2YIMD	Strong	Biomarker	[24]
Female hypogonadism	DISWASB4	moderate	Biomarker	[25]
Frontotemporal dementia	DISKYHXL	moderate	Genetic Variation	[26]
Juvenile amyotrophic lateral sclerosis	DISKDZC9	moderate	Genetic Variation	[27]
Spinocerebellar ataxia type 31	DISUPR8L	Disputed	Genetic Variation	[28]
Amyotrophic lateral sclerosis type 2, juvenile	DISYFHD8	Limited	Genetic Variation	[29]
Congenital generalized lipodystrophy	DIS4XF8N	Limited	Biomarker	[30]
Peripheral neuropathy	DIS7KN5G	Limited	Genetic Variation	[12]
Progressive supranuclear palsy	DISO5KRQ	Limited	Genetic Variation	[26]

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Probable helicase senataxin (SETX).	[31]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Probable helicase senataxin (SETX).	[32]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Probable helicase senataxin (SETX).	[33]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Probable helicase senataxin (SETX).	[34]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Probable helicase senataxin (SETX).	[35]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Probable helicase senataxin (SETX).	[36]
Clozapine	DMFC71L	Approved	Clozapine increases the expression of Probable helicase senataxin (SETX).	[36]
Cidofovir	DMA13GD	Approved	Cidofovir decreases the expression of Probable helicase senataxin (SETX).	[34]
Clodronate	DM9Y6X7	Approved	Clodronate decreases the expression of Probable helicase senataxin (SETX).	[34]
Geldanamycin	DMS7TC5	Discontinued in Phase 2	Geldanamycin increases the expression of Probable helicase senataxin (SETX).	[39]
Torcetrapib	DMDHYM7	Discontinued in Phase 2	Torcetrapib increases the expression of Probable helicase senataxin (SETX).	[40]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
TAK-243	DM4GKV2	Phase 1	TAK-243 affects the sumoylation of Probable helicase senataxin (SETX).	[37]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Probable helicase senataxin (SETX).	[38]
Coumarin	DM0N8ZM	Investigative	Coumarin decreases the phosphorylation of Probable helicase senataxin (SETX).	[38]

References

• [1] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [2] 1p/19q codeletion and IDH1/2 mutation identified a subtype of anaplastic oligoastrocytomas with prognosis as favorable as anaplastic oligodendrogliomas.Neuro Oncol. 2013 Jun;15(6):775-82. doi: 10.1093/neuonc/not027. Epub 2013 Mar 13.
• [3] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [4] Genetic analysis of undiagnosed ataxia-telangiectasia-like disorders.Brain Dev. 2019 Feb;41(2):150-157. doi: 10.1016/j.braindev.2018.09.007. Epub 2018 Oct 6.
• [5] Novel mutations in ataxia telangiectasia and AOA2 associated with prolonged survival.J Neurol Sci. 2013 Dec 15;335(1-2):134-8. doi: 10.1016/j.jns.2013.09.014. Epub 2013 Sep 17.
• [6] Association of genetic variants in senataxin and Alzheimer's disease in a Chinese Han population in Taiwan.Chin J Physiol. 2014 Apr 30;57(2):83-9. doi: 10.4077/CJP.2014.BAC228.
• [7] Characterization of two novel SETX mutations in AOA2 patients reveals aspects of the pathophysiological role of senataxin.Neurogenetics. 2010 Feb;11(1):91-100. doi: 10.1007/s10048-009-0206-0. Epub 2009 Jul 11.
• [8] Clinical and molecular characterization of ataxia with oculomotor apraxia patients in Saudi Arabia.BMC Med Genet. 2011 Feb 16;12:27. doi: 10.1186/1471-2350-12-27.
• [9] Disruption of Spermatogenesis and Infertility in Ataxia with Oculomotor Apraxia Type 2 (AOA2).Cerebellum. 2019 Jun;18(3):448-456. doi: 10.1007/s12311-019-01012-w.
• [10] Advantages and pitfalls of an extended gene panel for investigating complex neurometabolic phenotypes.Brain. 2016 Nov 1;139(11):2844-2854. doi: 10.1093/brain/aww221.
• [11] Epidemiological, clinical, paraclinical and molecular study of a cohort of 102 patients affected with autosomal recessive progressive cerebellar ataxia from Alsace, Eastern France: implications for clinical management.Neurogenetics. 2010 Feb;11(1):1-12. doi: 10.1007/s10048-009-0196-y. Epub 2009 May 14.
• [12] Ataxia with oculomotor apraxia type 2: clinical, biological and genotype/phenotype correlation study of a cohort of 90 patients.Brain. 2009 Oct;132(Pt 10):2688-98. doi: 10.1093/brain/awp211. Epub 2009 Aug 20.
• [13] Investigation of recessive ataxia loci in patients with young age of onset.Neuropediatrics. 2007 Aug;38(4):207-9. doi: 10.1055/s-2007-990268.
• [14] Autosomal recessive cerebellar ataxias.Orphanet J Rare Dis. 2006 Nov 17;1:47. doi: 10.1186/1750-1172-1-47.
• [15] Germ cell arrest associated with aSETX mutation in ataxia oculomotor apraxia type 2.Reprod Biomed Online. 2019 Jun;38(6):961-965. doi: 10.1016/j.rbmo.2018.12.042. Epub 2019 Jan 9.
• [16] Association of specific gene mutations derived from machine learning with survival in lung adenocarcinoma.PLoS One. 2018 Nov 12;13(11):e0207204. doi: 10.1371/journal.pone.0207204. eCollection 2018.
• [17] Unwinding the role of senataxin in neurodegeneration.Discov Med. 2015 Feb;19(103):127-36.
• [18] Senataxin resolves RNA:DNA hybrids forming at DNA double-strand breaks to prevent translocations.Nat Commun. 2018 Feb 7;9(1):533. doi: 10.1038/s41467-018-02894-w.
• [19] Ataxia with oculomotor apraxia type 2: a clinical and genetic study of 19 patients.J Neurol Sci. 2009 Mar 15;278(1-2):77-81. doi: 10.1016/j.jns.2008.12.004. Epub 2009 Jan 11.
• [20] Repeatability of radiomics and machine learning for DWI: Short-term repeatability study of 112 patients with prostate cancer.Magn Reson Med. 2020 Jun;83(6):2293-2309. doi: 10.1002/mrm.28058. Epub 2019 Nov 8.
• [21] SETX gene mutation in a family diagnosed autosomal dominant proximal spinal muscular atrophy.Neuromuscul Disord. 2012 Mar;22(3):258-62. doi: 10.1016/j.nmd.2011.09.006. Epub 2011 Nov 15.
• [22] Associations between HLA class I and cytochrome P450 2C9 genetic polymorphisms and phenytoin-related severe cutaneous adverse reactions in a Thai population.Pharmacogenet Genomics. 2016 May;26(5):225-34. doi: 10.1097/FPC.0000000000000211.
• [23] Combined deficiency of Senataxin and DNA-PKcs causes DNA damage accumulation and neurodegeneration in spinal muscular atrophy.Nucleic Acids Res. 2018 Sep 19;46(16):8326-8346. doi: 10.1093/nar/gky641.
• [24] A Nanostructured Lipid System to Improve the Oral Bioavailability of Ruthenium(II) Complexes for the Treatment of Infections Caused by Mycobacterium tuberculosis.Front Microbiol. 2018 Dec 6;9:2930. doi: 10.3389/fmicb.2018.02930. eCollection 2018.
• [25] Sensorimotor neuronopathy in ataxia with oculomotor apraxia type 2.Muscle Nerve. 2009 Sep;40(3):481-5. doi: 10.1002/mus.21328.
• [26] Selective Genetic Overlap Between Amyotrophic Lateral Sclerosis and Diseases of the Frontotemporal Dementia Spectrum.JAMA Neurol. 2018 Jul 1;75(7):860-875. doi: 10.1001/jamaneurol.2018.0372.
• [27] A novel SETX gene mutation associated with Juvenile amyotrophic lateral sclerosis.Brain Behav. 2018 Sep;8(9):e01066. doi: 10.1002/brb3.1066. Epub 2018 Jul 27.
• [28] Mutations in rare ataxia genes are uncommon causes of sporadic cerebellar ataxia.Mov Disord. 2012 Mar;27(3):442-6. doi: 10.1002/mds.24064. Epub 2012 Jan 27.
• [29] Autosomal recessive ataxia with peripheral neuropathy and elevated AFP: novel mutations in SETX.Neurology. 2006 May 23;66(10):1580-1. doi: 10.1212/01.wnl.0000216135.59699.9b.
• [30] Relative contribution of mutations in genes for autosomal dominant distal hereditary motor neuropathies: a genotype-phenotype correlation study.Brain. 2008 May;131(Pt 5):1217-27. doi: 10.1093/brain/awn029. Epub 2008 Mar 5.
• [31] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [32] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [33] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [34] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [35] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [36] Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
• [37] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [38] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [39] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [40] Clarifying off-target effects for torcetrapib using network pharmacology and reverse docking approach. BMC Syst Biol. 2012 Dec 10;6:152.