Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTINJV20)

• DOT Name: Dihydropyrimidinase-related protein 3 (DPYSL3)
• Synonyms: DRP-3; Collapsin response mediator protein 4; CRMP-4; Unc-33-like phosphoprotein 1; ULIP-1
• Gene Name: DPYSL3
• Related Disease:
  Advanced cancer
  Alzheimer disease
  Autism spectrum disorder
  Breast cancer
  Breast carcinoma
  Chronic pancreatitis
  Epilepsy
  Hepatocellular carcinoma
  Lentivirus infection
  Lung cancer
  Lung carcinoma
  Lung neoplasm
  Metastatic malignant neoplasm
  Neuroblastoma
  Non-alcoholic fatty liver disease
  Pancreatitis
  Pancreatic ductal carcinoma
  Prostate carcinoma
  Atrial septal defect
  Autosomal dominant cerebellar ataxia type II
  Gastric cancer
  Lymphoma
  Pancreatic cancer
  Prostate cancer
  Stomach cancer
• UniProt ID: DPYL3_HUMAN
• PDB ID: 4BKN; 4CNS; 4CNT; 4CNU
• Pfam ID: PF01979
• Sequence:
  MSYQGKKNIPRITSDRLLIKGGRIVNDDQSFYADIYMEDGLIKQIGDNLIVPGGVKTIEA
  NGKMVIPGGIDVHTHFQMPYKGMTTVDDFFQGTKAALAGGTTMIIDHVVPEPESSLTEAY
  EKWREWADGKSCCDYALHVDITHWNDSVKQEVQNLIKDKGVNSFMVYMAYKDLYQVSNTE
  LYEIFTCLGELGAIAQVHAENGDIIAQEQTRMLEMGITGPEGHVLSRPEELEAEAVFRAI
  TIASQTNCPLYVTKVMSKSAADLISQARKKGNVVFGEPITASLGIDGTHYWSKNWAKAAA
  FVTSPPLSPDPTTPDYINSLLASGDLQLSGSAHCTFSTAQKAIGKDNFTAIPEGTNGVEE
  RMSVIWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRISVGSDSDLVIWDPDAVKIV
  SAKNHQSAAEYNIFEGMELRGAPLVVICQGKIMLEDGNLHVTQGAGRFIPCSPFSDYVYK
  RIKARRKMADLHAVPRGMYDGPVFDLTTTPKGGTPAGSARGSPTRPNPPVRNLHQSGFSL
  SGTQVDEGVRSASKRIVAPPGGRSNITSLS
• Function: Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance, neuronal growth cone collapse and cell migration.
• Tissue Specificity: Mainly expressed in heart and skeletal muscle. Also strongly expressed in fetal brain and spinal cord.
• Reactome Pathway: CRMPs in Sema3A signaling (R-HSA-399956)

Molecular Interaction Atlas (MIA) of This DOT

25 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Biomarker	[1]
Alzheimer disease	DISF8S70	Strong	Altered Expression	[2]
Autism spectrum disorder	DISXK8NV	Strong	Biomarker	[3]
Breast cancer	DIS7DPX1	Strong	Biomarker	[4]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[4]
Chronic pancreatitis	DISBUOMJ	Strong	Biomarker	[5]
Epilepsy	DISBB28L	Strong	Biomarker	[6]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[7]
Lentivirus infection	DISX17PY	Strong	Genetic Variation	[8]
Lung cancer	DISCM4YA	Strong	Altered Expression	[9]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[9]
Lung neoplasm	DISVARNB	Strong	Biomarker	[9]
Metastatic malignant neoplasm	DIS86UK6	Strong	Biomarker	[1]
Neuroblastoma	DISVZBI4	Strong	Biomarker	[10]
Non-alcoholic fatty liver disease	DISDG1NL	Strong	Altered Expression	[11]
Pancreatitis	DIS0IJEF	Strong	Altered Expression	[5]
Pancreatic ductal carcinoma	DIS26F9Q	moderate	Biomarker	[12]
Prostate carcinoma	DISMJPLE	moderate	Posttranslational Modification	[13]
Atrial septal defect	DISJT76B	Limited	Altered Expression	[14]
Autosomal dominant cerebellar ataxia type II	DIS0PM39	Limited	Biomarker	[15]
Gastric cancer	DISXGOUK	Limited	Altered Expression	[16]
Lymphoma	DISN6V4S	Limited	Posttranslational Modification	[17]
Pancreatic cancer	DISJC981	Limited	Biomarker	[5]
Prostate cancer	DISF190Y	Limited	Posttranslational Modification	[13]
Stomach cancer	DISKIJSX	Limited	Altered Expression	[16]

26 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Dihydropyrimidinase-related protein 3 (DPYSL3).	[18]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Dihydropyrimidinase-related protein 3 (DPYSL3).	[19]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Dihydropyrimidinase-related protein 3 (DPYSL3).	[20]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Dihydropyrimidinase-related protein 3 (DPYSL3).	[21]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Dihydropyrimidinase-related protein 3 (DPYSL3).	[22]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Dihydropyrimidinase-related protein 3 (DPYSL3).	[23]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Dihydropyrimidinase-related protein 3 (DPYSL3).	[24]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Dihydropyrimidinase-related protein 3 (DPYSL3).	[25]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Dihydropyrimidinase-related protein 3 (DPYSL3).	[26]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Dihydropyrimidinase-related protein 3 (DPYSL3).	[27]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil affects the expression of Dihydropyrimidinase-related protein 3 (DPYSL3).	[28]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of Dihydropyrimidinase-related protein 3 (DPYSL3).	[30]
Clozapine	DMFC71L	Approved	Clozapine decreases the expression of Dihydropyrimidinase-related protein 3 (DPYSL3).	[31]
Cidofovir	DMA13GD	Approved	Cidofovir increases the expression of Dihydropyrimidinase-related protein 3 (DPYSL3).	[23]
Clodronate	DM9Y6X7	Approved	Clodronate increases the expression of Dihydropyrimidinase-related protein 3 (DPYSL3).	[23]
Adefovir dipivoxil	DMMAWY1	Approved	Adefovir dipivoxil increases the expression of Dihydropyrimidinase-related protein 3 (DPYSL3).	[23]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Dihydropyrimidinase-related protein 3 (DPYSL3).	[32]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Dihydropyrimidinase-related protein 3 (DPYSL3).	[33]
OTX-015	DMI8RG1	Phase 1/2	OTX-015 increases the expression of Dihydropyrimidinase-related protein 3 (DPYSL3).	[34]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Dihydropyrimidinase-related protein 3 (DPYSL3).	[36]
Mivebresib	DMCPF90	Phase 1	Mivebresib increases the expression of Dihydropyrimidinase-related protein 3 (DPYSL3).	[34]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Dihydropyrimidinase-related protein 3 (DPYSL3).	[37]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Dihydropyrimidinase-related protein 3 (DPYSL3).	[38]
UNC0379	DMD1E4J	Preclinical	UNC0379 increases the expression of Dihydropyrimidinase-related protein 3 (DPYSL3).	[39]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Dihydropyrimidinase-related protein 3 (DPYSL3).	[40]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Dihydropyrimidinase-related protein 3 (DPYSL3).	[41]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the methylation of Dihydropyrimidinase-related protein 3 (DPYSL3).	[29]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Dihydropyrimidinase-related protein 3 (DPYSL3).	[35]

References

• [1] Suppression of Prostate Cancer Metastasis by DPYSL3-Targeted saRNA.Adv Exp Med Biol. 2017;983:207-216. doi: 10.1007/978-981-10-4310-9_15.
• [2] Collapsin response mediator protein-2 hyperphosphorylation is an early event in Alzheimer's disease progression.J Neurochem. 2007 Nov;103(3):1132-44. doi: 10.1111/j.1471-4159.2007.04829.x. Epub 2007 Aug 7.
• [3] Crmp4-KO Mice as an Animal Model for Investigating Certain Phenotypes of Autism Spectrum Disorders.Int J Mol Sci. 2019 May 20;20(10):2485. doi: 10.3390/ijms20102485.
• [4] DPYSL3 modulates mitosis, migration, and epithelial-to-mesenchymal transition in claudin-low breast cancer.Proc Natl Acad Sci U S A. 2018 Dec 18;115(51):E11978-E11987. doi: 10.1073/pnas.1810598115. Epub 2018 Nov 29.
• [5] Caerulein-induced pancreatitis augments the expression and phosphorylation of collapsin response mediator protein 4.J Hepatobiliary Pancreat Sci. 2016 Jul;23(7):422-31. doi: 10.1002/jhbp.361. Epub 2016 Jun 12.
• [6] Developmental lineage of cell types in cortical dysplasia with balloon cells.Brain. 2007 Sep;130(Pt 9):2267-76. doi: 10.1093/brain/awm175.
• [7] Dihydropyrimidinase-like 3 is a putative hepatocellular carcinoma tumor suppressor.J Gastroenterol. 2015 May;50(5):590-600. doi: 10.1007/s00535-014-0993-4. Epub 2014 Aug 31.
• [8] Upregulation of CRMP4, a new prostate cancer metastasis suppressor gene, inhibits tumor growth in a nude mouse intratibial injection model.Int J Oncol. 2015 Jan;46(1):290-8. doi: 10.3892/ijo.2014.2705. Epub 2014 Oct 10.
• [9] Inhibition of cell-adhesion protein DPYSL3 promotes metastasis of lung cancer.Respir Res. 2018 Mar 7;19(1):41. doi: 10.1186/s12931-018-0740-0.
• [10] Dihydropyrimidinase-like protein 3 expression is negatively regulated by MYCN and associated with clinical outcome in neuroblastoma.Cancer Sci. 2013 Dec;104(12):1586-92. doi: 10.1111/cas.12278. Epub 2013 Oct 21.
• [11] Identification of core gene networks and hub genes associated with progression of non-alcoholic fatty liver disease by RNA sequencing.Hepatol Res. 2017 Dec;47(13):1445-1458. doi: 10.1111/hepr.12877. Epub 2017 Mar 29.
• [12] Quantitative proteomic profiling identifies DPYSL3 as pancreatic ductal adenocarcinoma-associated molecule that regulates cell adhesion and migration by stabilization of focal adhesion complex.PLoS One. 2013 Dec 5;8(12):e79654. doi: 10.1371/journal.pone.0079654. eCollection 2013.
• [13] Combined analysis of CRMP4 methylation levels and CAPRA-S score predicts metastasis and outcomes in prostate cancer patients.Asian J Androl. 2018 Jan-Feb;20(1):56-61. doi: 10.4103/aja.aja_3_17.
• [14] Human CRMP4 mutation and disrupted Crmp4 expression in mice are associated with ASD characteristics and sexual dimorphism.Sci Rep. 2017 Dec 1;7(1):16812. doi: 10.1038/s41598-017-16782-8.
• [15] Comparison of microarray-based mRNA profiling technologies for identification of psychiatric disease and drug signatures.J Neurosci Methods. 2004 Sep 30;138(1-2):173-88. doi: 10.1016/j.jneumeth.2004.04.002.
• [16] Serum levels of ANOS1 serve as a diagnostic biomarker of gastric cancer: a prospective multicenter observational study.Gastric Cancer. 2020 Mar;23(2):203-211. doi: 10.1007/s10120-019-00995-z. Epub 2019 Aug 3.
• [17] Collapsin response mediator protein 4 promotor methylation level as a potential predictor for diagnosing primary malignant lymphoma of the prostate.Cancer Cell Int. 2018 Jan 4;18:3. doi: 10.1186/s12935-017-0484-9. eCollection 2018.
• [18] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [19] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [20] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [21] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [22] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [23] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [24] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [25] Proteomics-based identification of differentially abundant proteins from human keratinocytes exposed to arsenic trioxide. J Proteomics Bioinform. 2014 Jul;7(7):166-178.
• [26] Oxidative stress modulates theophylline effects on steroid responsiveness. Biochem Biophys Res Commun. 2008 Dec 19;377(3):797-802.
• [27] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [28] Cell-type-specific responses to chemotherapeutics in breast cancer. Cancer Res. 2004 Jun 15;64(12):4218-26.
• [29] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [30] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [31] Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
• [32] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [33] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [34] Comprehensive transcriptome profiling of BET inhibitor-treated HepG2 cells. PLoS One. 2022 Apr 29;17(4):e0266966. doi: 10.1371/journal.pone.0266966. eCollection 2022.
• [35] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [36] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [37] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [38] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [39] Epigenetic siRNA and chemical screens identify SETD8 inhibition as a therapeutic strategy for p53 activation in high-risk neuroblastoma. Cancer Cell. 2017 Jan 9;31(1):50-63.
• [40] Cultured human peripheral blood mononuclear cells alter their gene expression when challenged with endocrine-disrupting chemicals. Toxicology. 2013 Jan 7;303:17-24.
• [41] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.