Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJWIO4T)

DOT Name Killer cell immunoglobulin-like receptor 3DS1 (KIR3DS1)
Synonyms Natural killer-associated transcript 10; NKAT-10
Gene Name KIR3DS1
Related Disease
Behcet disease ( )
Malaria ( )
Multiple sclerosis ( )
Acute graft versus host disease ( )
Acute myelogenous leukaemia ( )
Arthropathy ( )
Autoimmune disease ( )
Childhood acute lymphoblastic leukemia ( )
Classic Hodgkin lymphoma ( )
Hepatitis B virus infection ( )
Hepatitis C virus infection ( )
Hepatocellular carcinoma ( )
HIV infectious disease ( )
Inflammatory bowel disease ( )
Irritable bowel syndrome ( )
Juvenile idiopathic arthritis ( )
Non-hodgkin lymphoma ( )
Osteoarthritis ( )
Plasma cell myeloma ( )
Psoriasis ( )
Respiratory papillomatosis ( )
Syphilis ( )
Advanced cancer ( )
Chronic renal failure ( )
End-stage renal disease ( )
Nephropathy ( )
Human T-lymphotropic virus 1 infectious disease ( )
Kaposi sarcoma ( )
Microscopic polyangiitis ( )
Rheumatoid arthritis ( )
UniProt ID
KI3S1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00047
Sequence
MLLMVVSMACVGLFLVQRAGPHMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFML
YKEDRIHVPIFHGRIFQEGFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPMVIMVTGN
HRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHREWISKDPSRLVGQIHDGVSKANF
SIGSMMRALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGLYEKPSLSAQPGPKVQAGESV
TLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHS
PYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNLRHLHILIGTSVVKIPFTILLFFLL
HRWCSNKKKCCCNGPRACREQK
Function Receptor on natural killer (NK) cells for MHC class I molecules. Upon interaction with peptide-free HLA-F open conformer, triggers NK cell degranulation and anti-viral cytokine production.
Tissue Specificity Expressed in NK and T-cell lines but not in B-lymphoblastoid cell lines or in a colon carcinoma cell line.
Reactome Pathway
DAP12 interactions (R-HSA-2172127 )

Molecular Interaction Atlas (MIA) of This DOT

30 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Behcet disease DISSYMBS Definitive Genetic Variation [1]
Malaria DISQ9Y50 Definitive Genetic Variation [2]
Multiple sclerosis DISB2WZI Definitive Biomarker [3]
Acute graft versus host disease DIS8KLVM Strong Biomarker [4]
Acute myelogenous leukaemia DISCSPTN Strong Biomarker [5]
Arthropathy DISVEERK Strong Biomarker [6]
Autoimmune disease DISORMTM Strong Biomarker [4]
Childhood acute lymphoblastic leukemia DISJ5D6U Strong Genetic Variation [7]
Classic Hodgkin lymphoma DISV1LU6 Strong Genetic Variation [8]
Hepatitis B virus infection DISLQ2XY Strong Biomarker [9]
Hepatitis C virus infection DISQ0M8R Strong Biomarker [10]
Hepatocellular carcinoma DIS0J828 Strong Genetic Variation [11]
HIV infectious disease DISO97HC Strong Altered Expression [12]
Inflammatory bowel disease DISGN23E Strong Genetic Variation [13]
Irritable bowel syndrome DIS27206 Strong Genetic Variation [13]
Juvenile idiopathic arthritis DISQZGBV Strong Genetic Variation [14]
Non-hodgkin lymphoma DISS2Y8A Strong Biomarker [15]
Osteoarthritis DIS05URM Strong Biomarker [6]
Plasma cell myeloma DIS0DFZ0 Strong Biomarker [16]
Psoriasis DIS59VMN Strong Genetic Variation [17]
Respiratory papillomatosis DISXL96I Strong Biomarker [18]
Syphilis DISJ73BS Strong Biomarker [19]
Advanced cancer DISAT1Z9 moderate Biomarker [20]
Chronic renal failure DISGG7K6 moderate Genetic Variation [21]
End-stage renal disease DISXA7GG moderate Genetic Variation [21]
Nephropathy DISXWP4P moderate Biomarker [21]
Human T-lymphotropic virus 1 infectious disease DISN5C4M Disputed Altered Expression [22]
Kaposi sarcoma DISC1H1Z Limited Biomarker [23]
Microscopic polyangiitis DIS74KSO Limited Biomarker [24]
Rheumatoid arthritis DISTSB4J Limited Genetic Variation [25]
------------------------------------------------------------------------------------
⏷ Show the Full List of 30 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Bortezomib DMNO38U Approved Bortezomib decreases the expression of Killer cell immunoglobulin-like receptor 3DS1 (KIR3DS1). [26]
------------------------------------------------------------------------------------

References

1 KIR3DL1/S1 Allotypes Contribute Differentially to the Development of Behet Disease.J Immunol. 2019 Sep 15;203(6):1629-1635. doi: 10.4049/jimmunol.1801178. Epub 2019 Aug 12.
2 Differential association of KIR gene loci to risk of malaria in ethnic groups of Assam, Northeast India.Infect Genet Evol. 2011 Dec;11(8):1921-8. doi: 10.1016/j.meegid.2011.08.017. Epub 2011 Aug 25.
3 Killer cell immunoglobulin-like receptor genes in Spanish multiple sclerosis patients.Mol Immunol. 2011 Sep;48(15-16):1896-902. doi: 10.1016/j.molimm.2011.05.018. Epub 2011 Jun 12.
4 Donor activating KIR3DS1 is associated with decreased acute GVHD in unrelated allogeneic hematopoietic stem cell transplantation.Blood. 2010 Apr 15;115(15):3162-5. doi: 10.1182/blood-2009-08-236943. Epub 2010 Feb 1.
5 Comparison of the KIR3DS1/Bw4 distribution in Chinese healthy and acute myeloid leukemia individuals.Hum Immunol. 2015 Mar;76(2-3):79-82. doi: 10.1016/j.humimm.2015.01.024. Epub 2015 Jan 27.
6 Polymorphisms of KIRs gene and HLA-C alleles in patients with ankylosing spondylitis: possible association with susceptibility to the disease.J Clin Immunol. 2008 Jul;28(4):343-9. doi: 10.1007/s10875-008-9183-6. Epub 2008 Feb 23.
7 Genetic associations of killer immunoglobulin like receptors and class I human leukocyte antigens on childhood acute lymphoblastic leukemia among north Indians.Hum Immunol. 2016 Jan;77(1):41-46. doi: 10.1016/j.humimm.2015.10.009. Epub 2015 Oct 21.
8 Association of killer cell immunoglobulin-like receptor genes with Hodgkin's lymphoma in a familial study.PLoS One. 2007 May 2;2(5):e406. doi: 10.1371/journal.pone.0000406.
9 KIR3DS1/HLA-B Bw4-80Ile Genotype Is Correlated with the IFN- Therapy Response in hepatitis B e antigen-Positive Chronic Hepatitis B.Front Immunol. 2017 Oct 11;8:1285. doi: 10.3389/fimmu.2017.01285. eCollection 2017.
10 Decreased interferon- production by NK cells from KIR haplotype B carriers in hepatitis C virus infection.Liver Int. 2019 Jul;39(7):1237-1245. doi: 10.1111/liv.14172. Epub 2019 Jun 26.
11 Genetic diversity of the KIR/HLA system and susceptibility to hepatitis C virus-related diseases.PLoS One. 2015 Feb 20;10(2):e0117420. doi: 10.1371/journal.pone.0117420. eCollection 2015.
12 HLA-F*01:01 presents peptides with N-terminal flexibility and a preferred length of 16 residues.Immunogenetics. 2019 May;71(5-6):353-360. doi: 10.1007/s00251-019-01112-1. Epub 2019 Apr 2.
13 Killer immunoglobulin-like receptor repertoire analysis in a Caucasian Spanish cohort with inflammatory bowel disease.Microbiol Immunol. 2016 Nov;60(11):787-792. doi: 10.1111/1348-0421.12447.
14 Natural killer cell activity and frequency of killer cell immunoglobulin-like receptors in children with different forms of juvenile idiopathic arthritis.Pediatr Allergy Immunol. 2013 Nov;24(7):691-6. doi: 10.1111/pai.12130.
15 Natural killer cell killer immunoglobulin-like gene receptor polymorphisms in non-Hodgkin lymphoma: possible association with clinical course.Leuk Lymphoma. 2015;56(10):2902-7. doi: 10.3109/10428194.2015.1014361. Epub 2015 Mar 27.
16 Interaction between KIR3DS1 and HLA-Bw4 predicts for progression-free survival after autologous stem cell transplantation in patients with multiple myeloma.Blood. 2010 Sep 23;116(12):2033-9. doi: 10.1182/blood-2010-03-273706. Epub 2010 Jun 18.
17 Psoriasis patients are enriched for genetic variants that protect against HIV-1 disease.PLoS Genet. 2012 Feb;8(2):e1002514. doi: 10.1371/journal.pgen.1002514. Epub 2012 Feb 16.
18 Activating killer cell immunoglobulin-like receptors 3DS1 and 2DS1 protect against developing the severe form of recurrent respiratory papillomatosis.Hum Immunol. 2010 Feb;71(2):212-9. doi: 10.1016/j.humimm.2009.10.009. Epub 2009 Oct 25.
19 Human leukocyte antigen-C and killer cell immunoglobulin-like receptor gene polymorphisms among patients with syphilis in a Chinese Han population.APMIS. 2012 Oct;120(10):828-35. doi: 10.1111/j.1600-0463.2012.02911.x. Epub 2012 May 7.
20 Interactions Between KIR3DS1 and HLA-F Activate Natural Killer Cells to Control HCV Replication in Cell Culture.Gastroenterology. 2018 Nov;155(5):1366-1371.e3. doi: 10.1053/j.gastro.2018.07.019. Epub 2018 Jul 19.
21 Distribution of Killer cell immunoglobulin like receptor genes in end stage renal disease among North Indian population.Hum Immunol. 2013 Oct;74(10):1339-45. doi: 10.1016/j.humimm.2013.06.015. Epub 2013 Jun 15.
22 In contrast to HIV, KIR3DS1 does not influence outcome in HTLV-1 retroviral infection.Hum Immunol. 2012 Aug;73(8):783-7. doi: 10.1016/j.humimm.2012.05.006. Epub 2012 May 17.
23 Risk of Classic Kaposi Sarcoma With Combinations of Killer Immunoglobulin-Like Receptor and Human Leukocyte Antigen Loci: A Population-Based Case-control Study.J Infect Dis. 2016 Feb 1;213(3):432-8. doi: 10.1093/infdis/jiv413. Epub 2015 Aug 12.
24 Association of killer cell immunoglobulin-like receptor genotypes with microscopic polyangiitis.Arthritis Rheum. 2006 Mar;54(3):992-7. doi: 10.1002/art.21653.
25 Associations of killer cell immunoglobulin like receptors with rheumatoid arthritis among North Indian population.Hum Immunol. 2014 Aug;75(8):802-7. doi: 10.1016/j.humimm.2014.05.014. Epub 2014 Jun 6.
26 The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.