Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTL9I7LO)

DOT Name	Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B)
Synonyms	Myeloid differentiation primary response protein MyD118; Negative growth regulatory protein MyD118
Gene Name	GADD45B
UniProt ID	GA45B_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF01248
Sequence	MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLA IDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCL LVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER
Function	Involved in the regulation of growth and apoptosis. Mediates activation of stress-responsive MTK1/MEKK4 MAPKKK.
KEGG Pathway	MAPK sig.ling pathway (hsa04010 ) NF-kappa B sig.ling pathway (hsa04064 ) FoxO sig.ling pathway (hsa04068 ) Cell cycle (hsa04110 ) p53 sig.ling pathway (hsa04115 ) Apoptosis (hsa04210 ) Cellular senescence (hsa04218 ) Epstein-Barr virus infection (hsa05169 ) Pathways in cancer (hsa05200 ) Transcriptio.l misregulation in cancer (hsa05202 ) Colorectal cancer (hsa05210 ) Pancreatic cancer (hsa05212 ) Endometrial cancer (hsa05213 ) Glioma (hsa05214 ) Thyroid cancer (hsa05216 ) Basal cell carcinoma (hsa05217 ) Melanoma (hsa05218 ) Chronic myeloid leukemia (hsa05220 ) Small cell lung cancer (hsa05222 ) Non-small cell lung cancer (hsa05223 ) Breast cancer (hsa05224 ) Hepatocellular carcinoma (hsa05225 ) Gastric cancer (hsa05226 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Fluorouracil	DMUM7HZ	Approved	Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B) decreases the response to substance of Fluorouracil.	[49]
------------------------------------------------------------------------------------

54 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[6]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[7]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[8]
Arsenic	DMTL2Y1	Approved	Arsenic decreases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[9]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[10]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[11]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[12]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[13]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[14]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[14]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[15]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[16]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[17]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[18]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[19]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[13]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[20]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[21]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[22]
Bortezomib	DMNO38U	Approved	Bortezomib increases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[23]
Azathioprine	DMMZSXQ	Approved	Azathioprine increases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[24]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[25]
Indomethacin	DMSC4A7	Approved	Indomethacin increases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[26]
Sorafenib	DMS8IFC	Approved	Sorafenib increases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[27]
Sertraline	DM0FB1J	Approved	Sertraline increases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[28]
Romidepsin	DMT5GNL	Approved	Romidepsin increases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[29]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[30]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[20]
MLN4924	DMP36KD	Phase 3	MLN4924 affects the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[31]
APR-246	DMNFADH	Phase 2	APR-246 increases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[32]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[34]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[35]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[36]
Flavonoid derivative 1	DMCQP0B	Patented	Flavonoid derivative 1 increases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[10]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[37]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[38]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[39]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[40]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[41]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[42]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A decreases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[43]
Glyphosate	DM0AFY7	Investigative	Glyphosate increases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[44]
AHPN	DM8G6O4	Investigative	AHPN increases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[45]
Resorcinol	DMM37C0	Investigative	Resorcinol decreases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[24]
Chlorpyrifos	DMKPUI6	Investigative	Chlorpyrifos increases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[46]
Bilirubin	DMI0V4O	Investigative	Bilirubin increases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[47]
acrolein	DMAMCSR	Investigative	acrolein increases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[48]
Chrysin	DM7V2LG	Investigative	Chrysin increases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[10]
Kaempferol	DMHEMUB	Investigative	Kaempferol increases the expression of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[10]
------------------------------------------------------------------------------------


⏷ Show the Full List of 54 Drug(s)

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Growth arrest and DNA damage-inducible protein GADD45 beta (GADD45B).	[33]
------------------------------------------------------------------------------------

References

1	Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2	Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
3	Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
4	Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
5	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
6	Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
7	Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
8	Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
9	Gene expression profiles in peripheral lymphocytes by arsenic exposure and skin lesion status in a Bangladeshi population. Cancer Epidemiol Biomarkers Prev. 2006 Jul;15(7):1367-75. doi: 10.1158/1055-9965.EPI-06-0106.
10	Flavones and flavonols exert cytotoxic effects on a human oesophageal adenocarcinoma cell line (OE33) by causing G2/M arrest and inducing apoptosis. Food Chem Toxicol. 2008 Jun;46(6):2042-53. doi: 10.1016/j.fct.2008.01.049. Epub 2008 Feb 7.
11	Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
12	Endoplasmic reticulum stress contributes to arsenic trioxide-induced intrinsic apoptosis in human umbilical and bone marrow mesenchymal stem cells. Environ Toxicol. 2016 Mar;31(3):314-28.
13	Time series analysis of oxidative stress response patterns in HepG2: a toxicogenomics approach. Toxicology. 2013 Apr 5;306:24-34.
14	Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
15	Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
16	Functional gene expression profile underlying methotrexate-induced senescence in human colon cancer cells. Tumour Biol. 2011 Oct;32(5):965-76.
17	Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
18	THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
19	The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
20	A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
21	Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
22	Cannabidiol enhances cytotoxicity of anti-cancer drugs in human head and neck squamous cell carcinoma. Sci Rep. 2020 Nov 26;10(1):20622. doi: 10.1038/s41598-020-77674-y.
23	Proteasome inhibitor PS-341 induces apoptosis through induction of endoplasmic reticulum stress-reactive oxygen species in head and neck squamous cell carcinoma cells. Mol Cell Biol. 2004 Nov;24(22):9695-704. doi: 10.1128/MCB.24.22.9695-9704.2004.
24	A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
25	CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
26	Mechanisms of indomethacin-induced alterations in the choline phospholipid metabolism of breast cancer cells. Neoplasia. 2006 Sep;8(9):758-71.
27	Induction of DNA damage-inducible gene GADD45beta contributes to sorafenib-induced apoptosis in hepatocellular carcinoma cells. Cancer Res. 2010 Nov 15;70(22):9309-18. doi: 10.1158/0008-5472.CAN-10-1033. Epub 2010 Nov 9.
28	Sertraline induces endoplasmic reticulum stress in hepatic cells. Toxicology. 2014 Aug 1;322:78-88. doi: 10.1016/j.tox.2014.05.007. Epub 2014 May 24.
29	A sequential treatment of depsipeptide followed by 5-azacytidine enhances Gadd45beta expression in hepatocellular carcinoma cells. Anticancer Res. 2007 Nov-Dec;27(6B):3783-9.
30	Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
31	The Nedd8-activating enzyme inhibitor MLN4924 thwarts microenvironment-driven NF-B activation and induces apoptosis in chronic lymphocytic leukemia B cells. Clin Cancer Res. 2014 Mar 15;20(6):1576-89. doi: 10.1158/1078-0432.CCR-13-0987.
32	Mutant p53 reactivation by PRIMA-1MET induces multiple signaling pathways converging on apoptosis. Oncogene. 2010 Mar 4;29(9):1329-38. doi: 10.1038/onc.2009.425. Epub 2009 Nov 30.
33	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
34	Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
35	Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
36	Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
37	Chemical stresses fail to mimic the unfolded protein response resulting from luminal load with unfolded polypeptides. J Biol Chem. 2018 Apr 13;293(15):5600-5612.
38	Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
39	From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
40	Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
41	Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
42	Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
43	Probiotic Bacillus subtilis CW14 reduces disruption of the epithelial barrier and toxicity of ochratoxin A to Caco-2?cells. Food Chem Toxicol. 2019 Apr;126:25-33. doi: 10.1016/j.fct.2019.02.009. Epub 2019 Feb 11.
44	Glyphosate-based herbicides at low doses affect canonical pathways in estrogen positive and negative breast cancer cell lines. PLoS One. 2019 Jul 11;14(7):e0219610. doi: 10.1371/journal.pone.0219610. eCollection 2019.
45	GADD45A is a mediator of CD437 induced apoptosis in ovarian carcinoma cells. J Cell Physiol. 2007 Sep;212(3):771-9. doi: 10.1002/jcp.21073.
46	Aryl-phosphorus-containing flame retardants induce oxidative stress, the p53-dependent DNA damage response and mitochondrial impairment in A549?cells. Environ Pollut. 2019 Jul;250:58-67. doi: 10.1016/j.envpol.2019.03.109. Epub 2019 Apr 4.
47	Global changes in gene regulation demonstrate that unconjugated bilirubin is able to upregulate and activate select components of the endoplasmic reticulum stress response pathway. J Biochem Mol Toxicol. 2010 Mar-Apr;24(2):73-88.
48	Toxicity of smoke extracts towards A549 lung cells: role of acrolein and suppression by carbonyl scavengers. Chem Biol Interact. 2010 Feb 12;183(3):416-24.
49	Interferon-gamma sensitizes hepatitis B virus-expressing hepatocarcinoma cells to 5-fluorouracil through inhibition of hepatitis B virus-mediated nuclear factor-kappaB activation. Cancer Sci. 2007 Nov;98(11):1758-66. doi: 10.1111/j.1349-7006.2007.00591.x. Epub 2007 Aug 16.