Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTN7K4XB)

DOT Name L-lactate dehydrogenase A chain (LDHA)
Synonyms LDH-A; EC 1.1.1.27; Cell proliferation-inducing gene 19 protein; LDH muscle subunit; LDH-M; Renal carcinoma antigen NY-REN-59
Gene Name LDHA
Related Disease
Glycogen storage disease due to lactate dehydrogenase M-subunit deficiency ( )
UniProt ID
LDHA_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1I10 ; 4AJP ; 4JNK ; 4L4R ; 4L4S ; 4M49 ; 4OJN ; 4OKN ; 4QO7 ; 4QO8 ; 4QSM ; 4QT0 ; 4R68 ; 4R69 ; 4RLS ; 4ZVV ; 5IXS ; 5IXY ; 5W8H ; 5W8I ; 5W8J ; 5W8K ; 5W8L ; 5ZJD ; 5ZJE ; 5ZJF ; 6BAD ; 6BAG ; 6BAX ; 6BAZ ; 6BB0 ; 6BB1 ; 6BB2 ; 6BB3 ; 6MV8 ; 6MVA ; 6Q0D ; 6Q13 ; 6SBU ; 6SBV ; 6ZZR ; 7M2N
EC Number
1.1.1.27
Pfam ID
PF02866 ; PF00056
Sequence
MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKG
EMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFI
IPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGV
HPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYE
VIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGI
SDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Function Interconverts simultaneously and stereospecifically pyruvate and lactate with concomitant interconversion of NADH and NAD(+).
Tissue Specificity Predominantly expressed in anaerobic tissues such as skeletal muscle and liver.
KEGG Pathway
Glycolysis / Gluconeogenesis (hsa00010 )
Cysteine and methionine metabolism (hsa00270 )
Pyruvate metabolism (hsa00620 )
Propanoate metabolism (hsa00640 )
Metabolic pathways (hsa01100 )
HIF-1 sig.ling pathway (hsa04066 )
Glucagon sig.ling pathway (hsa04922 )
Central carbon metabolism in cancer (hsa05230 )
Reactome Pathway
Pyruvate metabolism (R-HSA-70268 )

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Glycogen storage disease due to lactate dehydrogenase M-subunit deficiency DISRX3JM Strong Autosomal recessive [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 5 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Paclitaxel DMLB81S Approved L-lactate dehydrogenase A chain (LDHA) increases the response to substance of Paclitaxel. [48]
Adenosine DMM2NSK Approved L-lactate dehydrogenase A chain (LDHA) increases the Cytogenetic abnormality ADR of Adenosine. [49]
Tobramycin DMUI0CH Approved L-lactate dehydrogenase A chain (LDHA) increases the Nephropathy toxic ADR of Tobramycin. [49]
Chlorpromazine DMBGZI3 Phase 3 Trial L-lactate dehydrogenase A chain (LDHA) increases the Hepatotoxicity ADR of Chlorpromazine. [49]
Leptin DM5LY1H Investigative L-lactate dehydrogenase A chain (LDHA) increases the Reproductive tract disorder ADR of Leptin. [49]
------------------------------------------------------------------------------------
49 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of L-lactate dehydrogenase A chain (LDHA). [2]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of L-lactate dehydrogenase A chain (LDHA). [3]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of L-lactate dehydrogenase A chain (LDHA). [4]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of L-lactate dehydrogenase A chain (LDHA). [5]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of L-lactate dehydrogenase A chain (LDHA). [6]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of L-lactate dehydrogenase A chain (LDHA). [7]
Estradiol DMUNTE3 Approved Estradiol increases the expression of L-lactate dehydrogenase A chain (LDHA). [8]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of L-lactate dehydrogenase A chain (LDHA). [9]
Quercetin DM3NC4M Approved Quercetin decreases the expression of L-lactate dehydrogenase A chain (LDHA). [10]
Temozolomide DMKECZD Approved Temozolomide decreases the expression of L-lactate dehydrogenase A chain (LDHA). [11]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of L-lactate dehydrogenase A chain (LDHA). [12]
Calcitriol DM8ZVJ7 Approved Calcitriol decreases the expression of L-lactate dehydrogenase A chain (LDHA). [13]
Marinol DM70IK5 Approved Marinol decreases the expression of L-lactate dehydrogenase A chain (LDHA). [14]
Phenobarbital DMXZOCG Approved Phenobarbital affects the expression of L-lactate dehydrogenase A chain (LDHA). [15]
Progesterone DMUY35B Approved Progesterone decreases the expression of L-lactate dehydrogenase A chain (LDHA). [16]
Menadione DMSJDTY Approved Menadione affects the expression of L-lactate dehydrogenase A chain (LDHA). [17]
Niclosamide DMJAGXQ Approved Niclosamide decreases the expression of L-lactate dehydrogenase A chain (LDHA). [18]
Ethanol DMDRQZU Approved Ethanol decreases the expression of L-lactate dehydrogenase A chain (LDHA). [19]
Etretinate DM2CZFA Approved Etretinate decreases the expression of L-lactate dehydrogenase A chain (LDHA). [21]
Mebendazole DMO14SG Approved Mebendazole decreases the expression of L-lactate dehydrogenase A chain (LDHA). [22]
Ropivacaine DMSPJG2 Approved Ropivacaine increases the expression of L-lactate dehydrogenase A chain (LDHA). [23]
Tramadol DMRQD04 Approved Tramadol decreases the expression of L-lactate dehydrogenase A chain (LDHA). [24]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of L-lactate dehydrogenase A chain (LDHA). [25]
Curcumin DMQPH29 Phase 3 Curcumin decreases the expression of L-lactate dehydrogenase A chain (LDHA). [26]
Fenretinide DMRD5SP Phase 3 Fenretinide decreases the expression of L-lactate dehydrogenase A chain (LDHA). [27]
FG-4592 DM4XSQ2 Phase 3 FG-4592 increases the expression of L-lactate dehydrogenase A chain (LDHA). [28]
GDC0941 DM1YAK6 Phase 2 GDC0941 decreases the expression of L-lactate dehydrogenase A chain (LDHA). [29]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the mutagenesis of L-lactate dehydrogenase A chain (LDHA). [30]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of L-lactate dehydrogenase A chain (LDHA). [31]
LY294002 DMY1AFS Phase 1 LY294002 decreases the expression of L-lactate dehydrogenase A chain (LDHA). [33]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of L-lactate dehydrogenase A chain (LDHA). [34]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the expression of L-lactate dehydrogenase A chain (LDHA). [5]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of L-lactate dehydrogenase A chain (LDHA). [35]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of L-lactate dehydrogenase A chain (LDHA). [36]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of L-lactate dehydrogenase A chain (LDHA). [37]
chloropicrin DMSGBQA Investigative chloropicrin decreases the expression of L-lactate dehydrogenase A chain (LDHA). [39]
3R14S-OCHRATOXIN A DM2KEW6 Investigative 3R14S-OCHRATOXIN A increases the expression of L-lactate dehydrogenase A chain (LDHA). [40]
Nickel chloride DMI12Y8 Investigative Nickel chloride increases the expression of L-lactate dehydrogenase A chain (LDHA). [28]
D-glucose DMMG2TO Investigative D-glucose increases the activity of L-lactate dehydrogenase A chain (LDHA). [41]
Phencyclidine DMQBEYX Investigative Phencyclidine decreases the expression of L-lactate dehydrogenase A chain (LDHA). [42]
Rapamycin Immunosuppressant Drug DM678IB Investigative Rapamycin Immunosuppressant Drug increases the expression of L-lactate dehydrogenase A chain (LDHA). [26]
CH-223191 DMMJZYC Investigative CH-223191 increases the expression of L-lactate dehydrogenase A chain (LDHA). [43]
PP-242 DM2348V Investigative PP-242 decreases the expression of L-lactate dehydrogenase A chain (LDHA). [44]
Benzoquinone DMNBA0G Investigative Benzoquinone increases the expression of L-lactate dehydrogenase A chain (LDHA). [45]
1,6-hexamethylene diisocyanate DMLB3RT Investigative 1,6-hexamethylene diisocyanate affects the expression of L-lactate dehydrogenase A chain (LDHA). [46]
Alpha-naphthoflavone DMELOIQ Investigative Alpha-naphthoflavone increases the expression of L-lactate dehydrogenase A chain (LDHA). [43]
TINGENIN B DMEV7FY Investigative TINGENIN B decreases the expression of L-lactate dehydrogenase A chain (LDHA). [47]
methyl-piperidino-pyrazole DMKTOPJ Investigative methyl-piperidino-pyrazole decreases the expression of L-lactate dehydrogenase A chain (LDHA). [8]
OXAMATE DMTYBC9 Investigative OXAMATE decreases the activity of L-lactate dehydrogenase A chain (LDHA). [48]
------------------------------------------------------------------------------------
⏷ Show the Full List of 49 Drug(s)
1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT
Drug Name Drug ID Highest Status Interaction REF
Dihydroartemisinin DMBXVMZ Approved Dihydroartemisinin affects the binding of L-lactate dehydrogenase A chain (LDHA). [20]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
TAK-243 DM4GKV2 Phase 1 TAK-243 increases the sumoylation of L-lactate dehydrogenase A chain (LDHA). [32]
Coumarin DM0N8ZM Investigative Coumarin increases the phosphorylation of L-lactate dehydrogenase A chain (LDHA). [38]
------------------------------------------------------------------------------------

References

1 The Gene Curation Coalition: A global effort to harmonize gene-disease evidence resources. Genet Med. 2022 Aug;24(8):1732-1742. doi: 10.1016/j.gim.2022.04.017. Epub 2022 May 4.
2 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
3 Proteomics investigations of drug-induced hepatotoxicity in HepG2 cells. Toxicol Sci. 2011 Mar;120(1):109-22.
4 Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
5 Gene expression changes associated with cytotoxicity identified using cDNA arrays. Funct Integr Genomics. 2000 Sep;1(2):114-26.
6 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
7 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
8 BPA exposure enhances the metastatic aggression of ovarian cancer through the ER/AKT/mTOR/HIF-1 signaling axis. Food Chem Toxicol. 2023 Jun;176:113792. doi: 10.1016/j.fct.2023.113792. Epub 2023 Apr 18.
9 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
10 Quercetin acts via the G3BP1/YWHAZ axis to inhibit glycolysis and proliferation in oral squamous cell carcinoma. Toxicol Mech Methods. 2023 Feb;33(2):141-150. doi: 10.1080/15376516.2022.2103480. Epub 2022 Aug 9.
11 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
12 Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
13 1,25-Dihydroxyvitamin D3 suppresses gene expression of eukaryotic translation initiation factor 2 in human promyelocytic leukemia HL-60 cells. Cell Struct Funct. 2005;30(1):1-6. doi: 10.1247/csf.30.1.
14 Single-cell Transcriptome Mapping Identifies Common and Cell-type Specific Genes Affected by Acute Delta9-tetrahydrocannabinol in Humans. Sci Rep. 2020 Feb 26;10(1):3450. doi: 10.1038/s41598-020-59827-1.
15 Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
16 Gene expression in endometrial cancer cells (Ishikawa) after short time high dose exposure to progesterone. Steroids. 2008 Jan;73(1):116-28.
17 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
18 Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
19 Gene expression signatures after ethanol exposure in differentiating embryoid bodies. Toxicol In Vitro. 2018 Feb;46:66-76.
20 Untargeted Proteomics and Systems-Based Mechanistic Investigation of Artesunate in Human Bronchial Epithelial Cells. Chem Res Toxicol. 2015 Oct 19;28(10):1903-13. doi: 10.1021/acs.chemrestox.5b00105. Epub 2015 Sep 21.
21 Consequences of the natural retinoid/retinoid X receptor ligands action in human breast cancer MDA-MB-231 cell line: Focus on functional proteomics. Toxicol Lett. 2017 Nov 5;281:26-34. doi: 10.1016/j.toxlet.2017.09.001. Epub 2017 Sep 5.
22 Mebendazole targets essential proteins in glucose metabolism leading gastric cancer cells to death. Toxicol Appl Pharmacol. 2023 Sep 15;475:116630. doi: 10.1016/j.taap.2023.116630. Epub 2023 Jul 18.
23 Dexmedetomidine protects against Ropivacaine-induced neuronal pyroptosis via the Nrf2/HO-1 pathway. J Toxicol Sci. 2023;48(3):139-148. doi: 10.2131/jts.48.139.
24 Comparative study of the neurotoxicological effects of tramadol and tapentadol in SH-SY5Y cells. Toxicology. 2016 Jun 1;359-360:1-10. doi: 10.1016/j.tox.2016.06.010. Epub 2016 Jun 15.
25 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
26 Inhibition of ATF4-mediated elevation of both autophagy and AKT/mTOR was involved in antitumorigenic activity of curcumin. Food Chem Toxicol. 2023 Mar;173:113609. doi: 10.1016/j.fct.2023.113609. Epub 2023 Jan 12.
27 4-HPR modulates gene expression in ovarian cells. Int J Cancer. 2006 Sep 1;119(5):1005-13. doi: 10.1002/ijc.21797.
28 Lactate released from human fibroblasts enhances Ni elution from Ni plate. Toxicology. 2021 Apr 15;453:152723. doi: 10.1016/j.tox.2021.152723. Epub 2021 Feb 14.
29 GDC-0941 inhibits metastatic characteristics of thyroid carcinomas by targeting both the phosphoinositide-3 kinase (PI3K) and hypoxia-inducible factor-1 (HIF-1) pathways. J Clin Endocrinol Metab. 2011 Dec;96(12):E1934-43. doi: 10.1210/jc.2011-1426. Epub 2011 Oct 12.
30 Exome-wide mutation profile in benzo[a]pyrene-derived post-stasis and immortal human mammary epithelial cells. Mutat Res Genet Toxicol Environ Mutagen. 2014 Dec;775-776:48-54. doi: 10.1016/j.mrgentox.2014.10.011. Epub 2014 Nov 4.
31 BET bromodomain inhibition targets both c-Myc and IL7R in high-risk acute lymphoblastic leukemia. Blood. 2012 Oct 4;120(14):2843-52.
32 Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
33 The anti-MDR efficacy of YAN against A549/Taxol cells is associated with its inhibition on glycolysis and is further enhanced by 2-deoxy-d-glucose. Chem Biol Interact. 2022 Feb 25;354:109843. doi: 10.1016/j.cbi.2022.109843. Epub 2022 Feb 2.
34 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
35 Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
36 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
37 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
38 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
39 Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
40 Ochratoxin A induces reprogramming of glucose metabolism by switching energy metabolism from oxidative phosphorylation to glycolysis in human gastric epithelium GES-1 cells in vitro. Toxicol Lett. 2020 Oct 15;333:232-241. doi: 10.1016/j.toxlet.2020.08.008. Epub 2020 Aug 22.
41 Panax notoginseng saponins improves healing of high glucose-induced wound through the GSK-3/-catenin pathway. Environ Toxicol. 2022 Aug;37(8):1867-1877. doi: 10.1002/tox.23533. Epub 2022 Apr 6.
42 Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.
43 2,3,7,8-Tetrachlorodibenzo-p-dioxin-mediated production of reactive oxygen species is an essential step in the mechanism of action to accelerate human keratinocyte differentiation. Toxicol Sci. 2013 Mar;132(1):235-49.
44 Marine biogenics in sea spray aerosols interact with the mTOR signaling pathway. Sci Rep. 2019 Jan 24;9(1):675.
45 Overexpression of HIF-1a could partially protect K562 cells from 1,4-benzoquinone induced toxicity by inhibiting ROS, apoptosis and enhancing glycolysis. Toxicol In Vitro. 2019 Mar;55:18-23. doi: 10.1016/j.tiv.2018.11.005. Epub 2018 Nov 15.
46 Gene profiles of a human alveolar epithelial cell line after in vitro exposure to respiratory (non-)sensitizing chemicals: identification of discriminating genetic markers and pathway analysis. Toxicol Lett. 2009 Feb 25;185(1):16-22. doi: 10.1016/j.toxlet.2008.11.017. Epub 2008 Dec 6.
47 22-hydroxytingenone reduces proliferation and invasion of human melanoma cells. Toxicol In Vitro. 2020 Aug;66:104879. doi: 10.1016/j.tiv.2020.104879. Epub 2020 Apr 29.
48 Discovery of N-hydroxyindole-based inhibitors of human lactate dehydrogenase isoform A (LDH-A) as starvation agents against cancer cells. J Med Chem. 2011 Mar 24;54(6):1599-612. doi: 10.1021/jm101007q. Epub 2011 Feb 18.
49 ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.